StarFunc result for job id Q7L5Y6

User Input

>input (550 residues)
MDHHVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPC
FLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRL
FERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFFEVYRNSESV
TPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIH
VFQVTPEGTFIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLL
VYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSEDVVTLRVTDPS
QASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQ
IQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPK
TCGDHPIRFYARDSGLLKFEIQAGLLGRPINHTVRRLVAFTFHPFEPFAISVQRTNAEYV
VNFHMRHCCT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7L5Y6	1.000	1.000	0.000	550	1.000	1.000	Q7L5Y6.pdb.gz	DET1_HUMAN DET1 homolog OS=Homo sapiens OX=9606 GN=DET1 PE=1 SV=2
2	AFDB:Q9ZNU6	0.820	0.861	2.970E-50	523	0.315	0.331	Q9ZNU6.pdb.gz	DET1_SOLLC Light-mediated development protein DET1 OS=Solanum lycopersicum OX=4081 GN=DET1 PE=1 SV=1
3	AFDB:P48732	0.816	0.826	1.208E-49	543	0.298	0.302	P48732.pdb.gz	DET1_ARATH Light-mediated development protein DET1 OS=Arabidopsis thaliana OX=3702 GN=DET1 PE=1 SV=2
4	AFDB:Q9VKM4	0.824	0.840	2.478E-45	539	0.258	0.263	Q9VKM4.pdb.gz	Q9VKM4_DROME Abnormal oocyte OS=Drosophila melanogaster OX=7227 GN=abo PE=4 SV=1
5	AFDB:Q550K3	0.846	0.327	6.201E-45	1462	0.340	0.128	Q550K3.pdb.gz	Q550K3_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277075 PE=4 SV=1
6	AFDB:Q95XT1	0.239	0.186	9.985E-9	746	0.131	0.097	Q95XT1.pdb.gz	Q95XT1_CAEEL SUPpressor of Rpm-1 OS=Caenorhabditis elegans OX=6239 GN=supr-1 PE=4 SV=1
7	AFDB:Q05040	0.293	0.306	2.283E-7	523	0.067	0.071	Q05040.pdb.gz	FAR8_YEAST Factor arrest protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAR8 PE=1 SV=1
8	AFDB:Q6RI45	0.233	0.103	3.331E-7	1802	0.095	0.029	Q6RI45.pdb.gz	BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BRWD3 PE=1 SV=2
9	AFDB:P90794	0.260	0.253	1.035E-6	571	0.109	0.105	P90794.pdb.gz	DCA11_CAEEL DDB1- and CUL4-associated factor 11 homolog OS=Caenorhabditis elegans OX=6239 GN=wdr-23 PE=3 SV=1
10	PDB:3rfhA	0.269	0.440	1.326E-6	291	0.078	0.148	3rfhA.pdb.gz
11	AFDB:Q969U6	0.288	0.282	1.430E-6	566	0.111	0.108	Q969U6.pdb.gz	FBXW5_HUMAN F-box/WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=FBXW5 PE=1 SV=1
12	PDB:6lqsB1	0.125	0.090	1.737E-6	806	0.075	0.051	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
13	PDB:2h9lA	0.232	0.339	2.275E-6	321	0.078	0.134	2h9lA.pdb.gz
14	PDB:8gqeA	0.290	0.412	3.145E-6	348	0.076	0.121	8gqeA.pdb.gz
15	PDB:4a11B	0.321	0.444	4.842E-6	365	0.065	0.099	4a11B.pdb.gz
16	PDB:6u62A	0.217	0.132	5.394E-6	1110	0.093	0.046	6u62A.pdb.gz	Structural basis for the docking of mTORC1 on the lysosomal surface.
17	PDB:7mqaLQ	0.211	0.148	6.342E-6	830	0.062	0.041	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:3jcmB	0.250	0.293	1.088E-5	429	0.085	0.110	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
19	PDB:5o9zL	0.302	0.350	1.088E-5	459	0.089	0.107	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
20	PDB:6ttuT	0.256	0.341	1.088E-5	394	0.091	0.127	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7L5Y6	0.0	1147	550	1.000	1.000	DET1_HUMAN DET1 homolog OS=Homo sapiens OX=9606 GN=DET1 PE=1 SV=2
2	Q9ZNU6	1.70e-83	271	523	0.335	0.352	DET1_SOLLC Light-mediated development protein DET1 OS=Solanum lycopersicum OX=4081 GN=DET1 PE=1 SV=1
3	P48732	3.26e-72	242	543	0.313	0.317	DET1_ARATH Light-mediated development protein DET1 OS=Arabidopsis thaliana OX=3702 GN=DET1 PE=1 SV=2
4	Q550K3	3.27e-55	203	1462	0.198	0.075	Q550K3_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277075 PE=4 SV=1
5	Q9VKM4	5.91e-46	171	539	0.273	0.278	Q9VKM4_DROME Abnormal oocyte OS=Drosophila melanogaster OX=7227 GN=abo PE=4 SV=1
6	Q95W10	1.91e-34	138	509	0.238	0.257	Q95W10_DROME ABO OS=Drosophila melanogaster OX=7227 GN=abo PE=4 SV=1
7	Q8MR99	1.79e-25	108	314	0.155	0.271	Q8MR99_DROME RH36510p OS=Drosophila melanogaster OX=7227 GN=abo PE=2 SV=1
8	P20241	0.028	40.0	1302	0.065	0.028	NRG_DROME Neuroglian OS=Drosophila melanogaster OX=7227 GN=Nrg PE=1 SV=2
9	Q9BWH6	0.16	37.4	1393	0.045	0.018	RPAP1_HUMAN RNA polymerase II-associated protein 1 OS=Homo sapiens OX=9606 GN=RPAP1 PE=1 SV=3
10	Q7ZTX2	0.59	35.0	334	0.025	0.042	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
11	P61964	0.60	35.0	334	0.025	0.042	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
12	P61965	0.60	35.0	334	0.025	0.042	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
13	Q498M4	0.60	35.0	334	0.025	0.042	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
14	Q9V3J8	0.61	35.0	361	0.025	0.039	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
15	Q17963	0.82	34.7	376	0.027	0.040	WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.1 PE=1 SV=1
16	Q9C0D6	0.85	35.0	1143	0.038	0.018	FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHDC1 PE=1 SV=2
17	K4CJJ1	1.5	34.3	581	0.044	0.041	NCED2_SOLLC 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic OS=Solanum lycopersicum OX=4081 GN=NCED2 PE=2 SV=1
18	B7Z018	1.6	31.2	73	0.033	0.247	B7Z018_DROME General transcription and DNA repair factor IIH subunit TFB5 OS=Drosophila melanogaster OX=7227 GN=Tfb5 PE=2 SV=2
19	P46873	1.6	33.9	699	0.035	0.027	OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4
20	Q9FPD6	2.0	33.5	492	0.035	0.039	Q9FPD6_ARATH Eukaryotic aspartyl protease family protein OS=Arabidopsis thaliana OX=3702 GN=At1g08210 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09737 Det1	2.4e-190	644.5	De-etiolated protein 1 Det1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000456340

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301764	0.999	DNA damage-binding protein 1
2	9606.ENSP00000364589	0.999	Cullin-4A
3	9606.ENSP00000352928	0.995	DET1- and DDB1-associated protein 1
4	9606.ENSP00000356641	0.993	E3 ubiquitin-protein ligase RFWD2
5	9606.ENSP00000384109	0.986	Cullin-4B
6	9606.ENSP00000216225	0.983	E3 ubiquitin-protein ligase RBX1
7	9606.ENSP00000256996	0.967	DNA damage-binding protein 2
8	9606.ENSP00000355958	0.966	Denticleless protein homolog
9	9606.ENSP00000231948	0.963	Protein cereblon
10	9606.ENSP00000393183	0.933	DDB1- and CUL4-associated factor 1
11	9606.ENSP00000351147	0.925	DDB1- and CUL4-associated factor 4
12	9606.ENSP00000366953	0.918	DDB1- and CUL4-associated factor 10
13	9606.ENSP00000356814	0.909	DDB1- and CUL4-associated factor 6
14	9606.ENSP00000415556	0.908	DDB1- and CUL4-associated factor 11
15	9606.ENSP00000252015	0.906	Short transient receptor potential channel 4-associated protein
16	9606.ENSP00000254337	0.904	DDB1- and CUL4-associated factor 15
17	9606.ENSP00000483236	0.902	DDB1- and CUL4-associated factor 7
18	9606.ENSP00000265038	0.901	DNA excision repair protein ERCC-8
19	9606.ENSP00000313034	0.901	F-box/WD repeat-containing protein 5
20	9606.ENSP00000228872	0.900	Cyclin-dependent kinase inhibitor 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:1990756	1.000	ubiquitin ligase-substrate adaptor activity
GO:0031625	1.000	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016567	0.993	protein ubiquitination
GO:0009987	0.992	cellular process
GO:0051173	0.987	positive regulation of nitrogen compound metabolic process
GO:0010604	0.986	positive regulation of macromolecule metabolic process
GO:0031325	0.986	positive regulation of cellular metabolic process
GO:0045732	0.982	positive regulation of protein catabolic process
GO:0061136	0.966	regulation of proteasomal protein catabolic process
GO:0031329	0.965	regulation of cellular catabolic process
GO:0032434	0.964	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:1901800	0.964	positive regulation of proteasomal protein catabolic process
GO:0016043	0.962	cellular component organization
GO:0031331	0.962	positive regulation of cellular catabolic process
GO:2000060	0.945	positive regulation of ubiquitin-dependent protein catabolic process
GO:0032436	0.939	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0044085	0.876	cellular component biogenesis
GO:0022607	0.799	cellular component assembly
GO:0065003	0.387	protein-containing complex assembly
GO:0044237	0.381	cellular metabolic process
GO:0050896	0.318	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031461	0.995	cullin-RING ubiquitin ligase complex
GO:0080008	0.994	Cul4-RING E3 ubiquitin ligase complex
GO:0070013	0.960	intracellular organelle lumen
GO:0005654	0.953	nucleoplasm
GO:0005737	0.792	cytoplasm
GO:0005829	0.589	cytosol
GO:0031464	0.532	Cul4A-RING E3 ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]