StarFunc result for job id Q7L622

User Input

>input (706 residues)
MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEG
VYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNF
ASFCWDHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI
NAGVFFFRCTICNNSDIFQKEMLRMGIHIPEKDASWELEENAYQELLQHYERCDVRRCRC
KEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECRGIIYNSGEFQKAKK
HVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGSKFRRNVSTLLIELGFQIKKK
TKRLYINKANIWNSALDAFRNRNFNPSYAIEVAYVIENDNFGSEHPGSKQEFLSLLMQHL
ENSSLFEGSLSKNLSLNSQALKENLYYEAGKMLAISLVHGGPSPGFFSKTLFNCLVYGPE
NTQPILDDVSDFDVAQIIIRINTATTVADLKSIINECYNYLELIGCLRLITTLSDKYMLV
KDILGYHVIQRVHTPFESFKQGLKTLGVLEKIQAYPEAFCSILCHKPESLSAKILSELFT
VHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDF
PVGNKCNNCLAIPITNTYKEFQENMDFTIRNTLRLEKEESSHYIGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V483	0.639	0.618	0.000	736	1.000	0.959	G3V483.pdb.gz	G3V483_HUMAN G2/M-phase specific E3 ubiquitin protein ligase OS=Homo sapiens OX=9606 GN=G2E3 PE=1 SV=1
2	AFDB:Q5RJY2	0.544	0.537	0.000	716	0.793	0.782	Q5RJY2.pdb.gz	G2E3_MOUSE G2/M phase-specific E3 ubiquitin-protein ligase OS=Mus musculus OX=10090 GN=G2e3 PE=2 SV=2
3	AFDB:A0A024R336	0.301	0.543	3.268E-33	381	0.197	0.365	A0A024R336.pdb.gz	A0A024R336_HUMAN PHD finger protein 7, isoform CRA_a OS=Homo sapiens OX=9606 GN=PHF7 PE=2 SV=1
4	AFDB:Q9W5W9	0.335	0.441	2.596E-24	520	0.142	0.192	Q9W5W9.pdb.gz	Q9W5W9_DROME LD43541p OS=Drosophila melanogaster OX=7227 GN=Phf7 PE=2 SV=2
5	AFDB:Q9VKW2	0.280	0.337	2.704E-23	582	0.153	0.186	Q9VKW2.pdb.gz	PIE_DROME Pineapple eye protein OS=Drosophila melanogaster OX=7227 GN=pie PE=1 SV=1
6	AFDB:O17736	0.386	0.281	5.729E-14	1001	0.089	0.063	O17736.pdb.gz	ETC1_CAEEL E3 ubiquitin-protein ligase etc-1 OS=Caenorhabditis elegans OX=6239 GN=etc-1 PE=1 SV=1
7	AFDB:Q9P2P5	0.350	0.169	1.528E-13	1572	0.095	0.043	Q9P2P5.pdb.gz	HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens OX=9606 GN=HECW2 PE=1 SV=2
8	AFDB:Q76N89	0.370	0.174	3.461E-13	1606	0.098	0.043	Q76N89.pdb.gz	HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens OX=9606 GN=HECW1 PE=1 SV=3
9	AFDB:P46935	0.241	0.196	4.545E-13	887	0.095	0.076	P46935.pdb.gz	NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus OX=10090 GN=Nedd4 PE=1 SV=3
10	AFDB:Q92462	0.237	0.221	5.069E-13	767	0.130	0.120	Q92462.pdb.gz	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2
11	PDB:7mopA	0.247	0.080	5.651E-10	2445	0.062	0.018	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
12	PDB:7jq9A	0.263	0.085	1.507E-9	2427	0.064	0.019	7jq9A.pdb.gz
13	PDB:7po4M	0.060	0.110	1.982E-1	269	0.040	0.104	7po4M.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
14	PDB:3in1A	0.054	0.087	2.465E-1	312	0.067	0.151	3in1A.pdb.gz	Crystal structure of a putative Ribokinase in complex with ADP from E.coli
15	PDB:1sxjE	0.069	0.131	4.251E-1	317	0.044	0.098	1sxjE.pdb.gz	Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
16	PDB:4cejB	0.058	0.039	5.286E-1	1156	0.055	0.034	4cejB.pdb.gz	Structural Basis for Translocation by Addab Helicase-Nuclease and its Arrest at Chi Sites.
17	PDB:7dvqC	0.067	0.056	5.582E-1	902	0.052	0.041	7dvqC.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:2jbhB	0.043	0.090	6.574E-1	213	0.013	0.042	2jbhB.pdb.gz	Structural and Functional Studies of the Human Phosphoribosyltransferase Domain Containing Protein 1.
19	PDB:6x0mO	0.061	0.153	7.741E-1	246	0.017	0.049	6x0mO.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
20	PDB:1a95B	0.046	0.141	8.175E-1	150	0.013	0.060	1a95B.pdb.gz	Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5GX24	0.0	1369	660	0.935	1.000	F5GX24_HUMAN G2/M-phase specific E3 ubiquitin protein ligase OS=Homo sapiens OX=9606 GN=G2E3 PE=1 SV=1
2	G3V483	0.0	1471	736	1.000	0.959	G3V483_HUMAN G2/M-phase specific E3 ubiquitin protein ligase OS=Homo sapiens OX=9606 GN=G2E3 PE=1 SV=1
3	Q5RJY2	0.0	1184	716	0.795	0.784	G2E3_MOUSE G2/M phase-specific E3 ubiquitin-protein ligase OS=Mus musculus OX=10090 GN=G2e3 PE=2 SV=2
4	Q7L622	0.0	1467	706	1.000	1.000	G2E3_HUMAN G2/M phase-specific E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=G2E3 PE=1 SV=1
5	A0A024R336	1.62e-72	242	381	0.183	0.339	A0A024R336_HUMAN PHD finger protein 7, isoform CRA_a OS=Homo sapiens OX=9606 GN=PHF7 PE=2 SV=1
6	Q9BWX1	1.62e-72	242	381	0.183	0.339	PHF7_HUMAN PHD finger protein 7 OS=Homo sapiens OX=9606 GN=PHF7 PE=1 SV=1
7	H7C4N0	1.34e-68	229	326	0.169	0.365	H7C4N0_HUMAN PHD finger protein 7 (Fragment) OS=Homo sapiens OX=9606 GN=PHF7 PE=1 SV=1
8	Q9VKW2	3.43e-44	169	582	0.132	0.160	PIE_DROME Pineapple eye protein OS=Drosophila melanogaster OX=7227 GN=pie PE=1 SV=1
9	Q9W5W9	4.17e-41	159	520	0.132	0.179	Q9W5W9_DROME LD43541p OS=Drosophila melanogaster OX=7227 GN=Phf7 PE=2 SV=2
10	Q9D4J7	7.08e-15	79.0	364	0.061	0.118	PHF6_MOUSE PHD finger protein 6 OS=Mus musculus OX=10090 GN=Phf6 PE=1 SV=1
11	Q8IWS0	1.45e-14	78.2	365	0.061	0.118	PHF6_HUMAN PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1
12	Q5JRC6	1.78e-14	77.4	324	0.058	0.127	Q5JRC6_HUMAN PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1
13	A0A0D9SGE8	2.61e-14	77.4	366	0.058	0.112	A0A0D9SGE8_HUMAN PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1
14	X6RH80	5.36e-10	61.2	168	0.048	0.202	X6RH80_HUMAN PHD finger protein 11 (Fragment) OS=Homo sapiens OX=9606 GN=PHF11 PE=1 SV=1
15	Q8BVM9	6.75e-10	63.2	293	0.045	0.109	PH11A_MOUSE PHD finger protein 11A OS=Mus musculus OX=10090 GN=Phf11a PE=2 SV=1
16	Q9UIL8	1.28e-09	62.8	331	0.048	0.103	PHF11_HUMAN PHD finger protein 11 OS=Homo sapiens OX=9606 GN=PHF11 PE=1 SV=3
17	C9JWH0	1.26e-07	53.1	133	0.044	0.233	C9JWH0_HUMAN PHD finger protein 11 (Fragment) OS=Homo sapiens OX=9606 GN=PHF11 PE=1 SV=1
18	H0Y4X7	4.67e-07	54.3	286	0.037	0.091	H0Y4X7_HUMAN PHD finger protein 11 (Fragment) OS=Homo sapiens OX=9606 GN=PHF11 PE=1 SV=1
19	Q8IRW8	1.19e-06	54.7	2431	0.047	0.014	TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster OX=7227 GN=trr PE=1 SV=2
20	Q9UMN6	1.49e-06	54.3	2715	0.044	0.011	KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00632 HECT	1e-06	40.1	HECT-domain (ubiquitin-transferase)
2	PF13771 zf-HC5HC2H	1.6e-15	68.4	PHD-like zinc-binding domain
3	PF13832 zf-HC5HC2H_2	0.00078	31.0	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000206595

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479266	0.693	Protein aurora borealis
2	9606.ENSP00000378857	0.680	WD repeat-containing protein 6
3	9606.ENSP00000369666	0.667	F-box/LRR-repeat protein 19
4	9606.ENSP00000260731	0.655	Kinesin-like protein KIF11
5	9606.ENSP00000305204	0.653	Cytoskeleton-associated protein 2-like
6	9606.ENSP00000344242	0.626	Leucine-rich repeat-containing protein 17
7	9606.ENSP00000370532	0.624	Transcription factor IIIA
8	9606.ENSP00000367638	0.612	Rho guanine nucleotide exchange factor 39
9	9606.ENSP00000247191	0.605	Disks large-associated protein 5
10	9606.ENSP00000370419	0.600	Tetratricopeptide repeat domain containing
11	9606.ENSP00000379176	0.591	Cyclin-dependent kinase-like 1
12	9606.ENSP00000288710	0.584	Dynein regulatory complex protein 1
13	9606.ENSP00000448955	0.576	GAS2-like protein 3
14	9606.ENSP00000417580	0.546	Isoamyl acetate-hydrolyzing esterase 1 homolog
15	9606.ENSP00000216756	0.532	Cyclin-dependent kinase 2-interacting protein
16	9606.ENSP00000262293	0.532	Proline-rich protein 11
17	9606.ENSP00000384545	0.532	BTB/POZ domain-containing protein 3
18	9606.ENSP00000387091	0.524	Protein ZNF365
19	9606.ENSP00000358813	0.518	Dual specificity protein kinase TTK
20	9606.ENSP00000319482	0.513	DCN1-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.998	catalytic activity, acting on a protein
GO:0016740	0.998	transferase activity
GO:0004842	0.988	ubiquitin-protein transferase activity
GO:0061630	0.973	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0032446	0.988	protein modification by small protein conjugation
GO:0048523	0.978	negative regulation of cellular process
GO:0023057	0.958	negative regulation of signaling
GO:0010648	0.958	negative regulation of cell communication
GO:0009966	0.953	regulation of signal transduction
GO:0009968	0.902	negative regulation of signal transduction
GO:0016567	0.831	protein ubiquitination
GO:1902531	0.705	regulation of intracellular signal transduction
GO:0042981	0.637	regulation of apoptotic process
GO:1902532	0.611	negative regulation of intracellular signal transduction
GO:2001242	0.606	regulation of intrinsic apoptotic signaling pathway
GO:0043069	0.517	negative regulation of programmed cell death
GO:0000209	0.496	protein polyubiquitination
GO:0032502	0.494	developmental process
GO:0043066	0.485	negative regulation of apoptotic process
GO:0009987	0.463	cellular process
GO:0032501	0.420	multicellular organismal process
GO:2001243	0.415	negative regulation of intrinsic apoptotic signaling pathway
GO:0001824	0.399	blastocyst development
GO:0019222	0.305	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005794	1.000	Golgi apparatus
GO:0005634	0.307	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]