StarFunc result for job id Q7L775

User Input

>input (607 residues)
MWMTPKRSKMEVDEALVFRPEWTQRYLVVEPPEGDGALCLVCRRLIVATRERDVRRHYEA
EHEYYERYVADGERAALVERLRQGDLPVASFTPEERAARAGLGLCRLLALKGRGWGEGDF
VYQCMEVLLREVLPEHVSVLQGVDLSPDITRQRILSIDRNLRNQLFNRARDFKAYSLALD
DQAFVAYENYLLVFIRGVGPELEVQEDLLTIINLTHHFSVGALMSAILESLQTAGLSLQR
MVGLTTTHTLRMIGENSGLVSYMREKAVSPNCWNVIHYSGFLHLELLSSYDVDVNQIINT
ISEWIVLIKTRGVRRPEFQTLLTESESEHGERVNGRCLNNWLRRGKTLKLIFSLRKEMEA
FLVSVGATTVHFSDKQWLCDFGFLVDIMEHLRELSEELRVSKVFAAAAFDHICTFEVKLN
LFQRHIEEKNLTDFPALREVVDELKQQNKEDEKIFDPDRYQMVICRLQKEFERHFKDLRF
IKKDLELFSNPFNFKPEYAPISVRVELTKLQANTNLWNEYRIKDLGQFYAGLSAESYPII
KGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVR
ERNESNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7L775	1.000	1.000	5.465E-91	607	1.000	1.000	Q7L775.pdb.gz	EPMIP_HUMAN EPM2A-interacting protein 1 OS=Homo sapiens OX=9606 GN=EPM2AIP1 PE=1 SV=1
2	AFDB:Q8VEH5	0.872	0.874	6.832E-82	606	0.886	0.888	Q8VEH5.pdb.gz	EPMIP_MOUSE EPM2A-interacting protein 1 OS=Mus musculus OX=10090 GN=Epm2aip1 PE=1 SV=1
3	AFDB:Q99NI3	0.591	0.392	8.014E-26	936	0.242	0.157	Q99NI3.pdb.gz	GT2D2_MOUSE General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1
4	AFDB:A0A494C1N8	0.558	0.322	4.251E-25	1116	0.252	0.137	A0A494C1N8.pdb.gz	A0A494C1N8_HUMAN GTF2I repeat domain containing 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
5	AFDB:B2RPU8	0.656	0.540	2.573E-24	756	0.206	0.165	B2RPU8.pdb.gz	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
6	AFDB:O95789	0.675	0.329	1.777E-23	1325	0.206	0.094	O95789.pdb.gz	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
7	AFDB:Q8IZ13	0.692	0.706	2.118E-23	594	0.193	0.197	Q8IZ13.pdb.gz	F200C_HUMAN Protein FAM200C OS=Homo sapiens OX=9606 GN=FAM200C PE=1 SV=1
8	AFDB:Q6R2W3	0.656	0.322	7.907E-23	1325	0.221	0.101	Q6R2W3.pdb.gz	SCND3_HUMAN SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCAND3 PE=1 SV=1
9	AFDB:Q8TCP9	0.682	0.719	3.085E-22	573	0.208	0.220	Q8TCP9.pdb.gz	F200A_HUMAN Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A PE=1 SV=1
10	AFDB:F4IE28	0.591	0.482	2.647E-14	769	0.191	0.151	F4IE28.pdb.gz	F4IE28_ARATH TTF-type zinc finger protein with HAT dimerization domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=LOH3 PE=4 SV=1
11	PDB:5lzqA	0.070	0.061	2.752E-1	725	0.056	0.047	5lzqA.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
12	PDB:2ivnA	0.094	0.160	4.086E-1	325	0.025	0.046	2ivnA.pdb.gz	An Archaeal Orthologue of the Universal Protein Kae1 is an Iron Metalloprotein which Exhibits Atypical DNA-Binding Properties and Apurinic-Endonuclease Activity in Vitro.
13	PDB:7oopM	0.135	0.109	6.920E-1	810	0.115	0.086	7oopM.pdb.gz	Structural basis of human transcription-DNA repair coupling.
14	PDB:7np7D4	0.110	0.143	7.231E-1	415	0.056	0.082	7np7D4.pdb.gz
15	PDB:7jhjR	0.077	0.130	9.006E-1	277	0.058	0.126	7jhjR.pdb.gz	Structural basis for the constitutive activity and immunomodulatory properties of the Epstein-Barr virus-encoded G protein-coupled receptor BILF1.
16	PDB:6gwjK	0.113	0.185	9.410E-1	334	0.041	0.075	6gwjK.pdb.gz	Defects in t 6 A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome.
17	PDB:3pjaL	0.102	0.215	9.833E-1	223	0.040	0.108	3pjaL.pdb.gz
18	PDB:3thwA	0.108	0.082	1.027	890	0.105	0.072	3thwA.pdb.gz	Mechanism of mismatch recognition revealed by human MutSbeta bound to unpaired DNA loops
19	PDB:7c9iC	0.095	0.184	1.027	243	0.049	0.123	7c9iC.pdb.gz	Structural basis of gamma-secretase inhibition and modulation by small molecule drugs.
20	PDB:3htvA	0.090	0.185	1.074	279	0.018	0.039	3htvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7L775	0.0	1254	607	1.000	1.000	EPMIP_HUMAN EPM2A-interacting protein 1 OS=Homo sapiens OX=9606 GN=EPM2AIP1 PE=1 SV=1
2	Q8VEH5	0.0	1131	606	0.890	0.891	EPMIP_MOUSE EPM2A-interacting protein 1 OS=Mus musculus OX=10090 GN=Epm2aip1 PE=1 SV=1
3	Q86UP8	4.61e-57	209	949	0.267	0.171	GTD2A_HUMAN General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3
4	A0A494C0I1	1.40e-56	208	1111	0.267	0.146	A0A494C0I1_HUMAN GTF2I repeat domain containing 2 OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=1
5	Q6EKJ0	1.43e-55	204	949	0.264	0.169	GTD2B_HUMAN General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
6	A0A494C1N8	2.76e-55	204	1116	0.265	0.144	A0A494C1N8_HUMAN GTF2I repeat domain containing 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
7	Q99NI3	1.01e-53	199	936	0.252	0.163	GT2D2_MOUSE General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1
8	B2RPU8	2.62e-22	103	756	0.226	0.181	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
9	Q8IZ13	1.14e-19	95.1	594	0.183	0.187	F200C_HUMAN Protein FAM200C OS=Homo sapiens OX=9606 GN=FAM200C PE=1 SV=1
10	Q8TCP9	2.96e-19	94.0	573	0.191	0.202	F200A_HUMAN Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A PE=1 SV=1
11	O95789	2.39e-18	92.0	1325	0.191	0.088	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
12	Q6R2W3	8.40e-18	90.1	1325	0.191	0.088	SCND3_HUMAN SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCAND3 PE=1 SV=1
13	Q8CEW7	4.50e-13	74.3	583	0.155	0.161	Q8CEW7_MOUSE DUF4371 domain-containing protein OS=Mus musculus OX=10090 GN=Zbed5 PE=2 SV=1
14	M0QZQ2	6.68e-05	48.5	796	0.040	0.030	M0QZQ2_HUMAN Mediator of RNA polymerase II transcription subunit 25 OS=Homo sapiens OX=9606 GN=MED25 PE=1 SV=3
15	F4IE28	0.99	35.0	769	0.066	0.052	F4IE28_ARATH TTF-type zinc finger protein with HAT dimerization domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=LOH3 PE=4 SV=1
16	Q9BUA3	3.0	33.1	381	0.028	0.045	SPNDC_HUMAN Spindlin interactor and repressor of chromatin-binding protein OS=Homo sapiens OX=9606 GN=SPINDOC PE=1 SV=3
17	Q05AH6	7.3	32.0	381	0.031	0.050	SPNDC_MOUSE Spindlin interactor and repressor of chromatin-binding protein OS=Mus musculus OX=10090 GN=Spindoc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14291 DUF4371	66	14.5	Domain of unknown function (DUF4371)
2	PF07200 Mod_r	82	14.7	Modifier of rudimentary (Mod(r)) protein
3	PF18658 zf-C2H2_12	7.2e-06	36.9	Spin-doc zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406027

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356489	0.890	Laforin
2	9606.ENSP00000409896	0.863	E3 ubiquitin-protein ligase CCNB1IP1
3	9606.ENSP00000387219	0.647	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
4	9606.ENSP00000254722	0.626	Pigment epithelium-derived factor
5	9606.ENSP00000238994	0.611	Protein phosphatase 1 regulatory subunit 3C
6	9606.ENSP00000217515	0.571	Thioredoxin-like protein 1
7	9606.ENSP00000345464	0.535	E3 ubiquitin-protein ligase NHLRC1
8	9606.ENSP00000231790	0.520	DNA mismatch repair protein Mlh1
9	9606.ENSP00000394484	0.500	Serine/threonine-protein kinase DCLK3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.987	cellular metabolic process
GO:0044238	0.978	primary metabolic process
GO:0044260	0.976	cellular macromolecule metabolic process
GO:0050794	0.971	regulation of cellular process
GO:0005977	0.929	glycogen metabolic process
GO:0009250	0.906	glucan biosynthetic process
GO:0005978	0.899	glycogen biosynthetic process
GO:0048522	0.820	positive regulation of cellular process
GO:0050896	0.712	response to stimulus
GO:0031323	0.681	regulation of cellular metabolic process
GO:1901698	0.482	response to nitrogen compound
GO:0050790	0.482	regulation of catalytic activity
GO:0010556	0.431	regulation of macromolecule biosynthetic process
GO:0080090	0.429	regulation of primary metabolic process
GO:0031326	0.429	regulation of cellular biosynthetic process
GO:0031325	0.427	positive regulation of cellular metabolic process
GO:0010033	0.396	response to organic substance
GO:0010243	0.376	response to organonitrogen compound
GO:0009725	0.376	response to hormone
GO:0010604	0.371	positive regulation of macromolecule metabolic process
GO:0051338	0.358	regulation of transferase activity
GO:2000112	0.356	regulation of cellular macromolecule biosynthetic process
GO:1901652	0.355	response to peptide
GO:0032868	0.353	response to insulin
GO:0062012	0.342	regulation of small molecule metabolic process
GO:0044093	0.340	positive regulation of molecular function
GO:0048519	0.334	negative regulation of biological process
GO:0043467	0.321	regulation of generation of precursor metabolites and energy
GO:0062013	0.321	positive regulation of small molecule metabolic process
GO:0043255	0.321	regulation of carbohydrate biosynthetic process
GO:0010906	0.321	regulation of glucose metabolic process
GO:0043085	0.318	positive regulation of catalytic activity
GO:0010557	0.318	positive regulation of macromolecule biosynthetic process
GO:0031328	0.316	positive regulation of cellular biosynthetic process
GO:0051347	0.314	positive regulation of transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0016020	0.997	membrane
GO:0012505	0.962	endomembrane system
GO:0031090	0.961	organelle membrane
GO:0098552	0.906	side of membrane
GO:0098562	0.900	cytoplasmic side of membrane
GO:0031984	0.900	organelle subcompartment
GO:0098554	0.885	cytoplasmic side of endoplasmic reticulum membrane
GO:0005829	0.511	cytosol
GO:0043228	0.420	non-membrane-bounded organelle
GO:0043232	0.365	intracellular non-membrane-bounded organelle
GO:0071944	0.364	cell periphery
GO:0031981	0.361	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]