StarFunc result for job id Q7L7X3

User Input

>input (1001 residues)
MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMS
YSGKQSTEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHK
KPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPAN
SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQN
ESPTLQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIFVLRERPETVLIDLIQRTKDA
VRELDNLQYRKMKKLLFQEAHNGPAVEAQEEEEEQDHGVGRTGTVNSVGSNQSIPSMSIS
ASSQSSSVNSLPDVSDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQ
SPPQVSRHKSHYRNREHFATIRTASLVTRQMQEHEQDSELREQMSGYKRMRRQHQKQLMT
LENKLKAEMDEHRLRLDKDLETQRNNFAAEMEKLIKKHQAAMEKEAKVMSNEEKKFQQHI
QAQQKKELNSFLESQKREYKLRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEE
ANLLRRQRQYLELECRRFKRRMLLGRHNLEQDLVREELNKRQTQKDLEHAMLLRQHESMQ
ELEFRHLNTIQKMRCELIRLQHQTELTNQLEYNKRRERELRRKHVMEVRQQPKSLKSKEL
QIKKQFQDTCKIQTRQYKALRNHLLETTPKSEHKAVLKRLKEEQTRKLAILAEQYDHSIN
EMLSTQALRLDEAQEAECQVLKMQLQQELELLNAYQSKIKMQAEAQHDRELRELEQRVSL
RRALLEQKIEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAF
SHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSM
GVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88664	0.860	0.860	0.000	1001	0.989	0.989	O88664.pdb.gz	TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus OX=10116 GN=Taok1 PE=1 SV=1
2	AFDB:X1WD79	0.626	0.559	2.563E-102	1138	0.725	0.638	X1WD79.pdb.gz	X1WD79_DANRE Serine/threonine-protein kinase TAO2 isoform X2 OS=Danio rerio OX=7955 GN=taok2a PE=1 SV=1
3	AFDB:A0A0R4IIN0	0.724	0.650	8.893E-100	1121	0.769	0.687	A0A0R4IIN0.pdb.gz	A0A0R4IIN0_DANRE Serine/threonine-protein kinase TAO2 isoform X4 OS=Danio rerio OX=7955 GN=taok2b PE=4 SV=2
4	AFDB:Q9H2K8	0.806	0.896	1.698E-98	898	0.652	0.727	Q9H2K8.pdb.gz	TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2
5	AFDB:Q0KHQ5	0.656	0.634	1.678E-77	1039	0.506	0.488	Q0KHQ5.pdb.gz	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
6	AFDB:Q6ZQ29	0.340	0.278	3.013E-72	1240	0.540	0.436	Q6ZQ29.pdb.gz	TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus OX=10090 GN=Taok2 PE=1 SV=3
7	AFDB:P46549	0.666	0.678	4.615E-64	982	0.363	0.370	P46549.pdb.gz	SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans OX=6239 GN=kin-18 PE=1 SV=1
8	AFDB:Q499L9	0.268	0.628	5.619E-29	416	0.131	0.315	Q499L9.pdb.gz	Q499L9_HUMAN Serine/threonine protein kinase MST4 OS=Homo sapiens OX=9606 GN=MST4 PE=1 SV=1
9	AFDB:O24527	0.277	0.331	7.194E-28	836	0.156	0.187	O24527.pdb.gz	SIK1_ARATH Serine/threonine-protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SIK1 PE=1 SV=1
10	AFDB:A0A0R4IN78	0.282	0.629	8.761E-27	432	0.142	0.329	A0A0R4IN78.pdb.gz	A0A0R4IN78_DANRE Serine/threonine kinase 24b (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk24 PE=1 SV=1
11	PDB:4eomC	0.238	0.808	2.909E-17	276	0.078	0.283	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
12	PDB:5u6yA	0.236	0.496	5.858E-17	459	0.078	0.170	5u6yA.pdb.gz
13	PDB:3eqdA	0.244	0.737	7.907E-17	315	0.083	0.263	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
14	PDB:2yaaA	0.248	0.776	2.375E-16	300	0.072	0.240	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
15	PDB:4krcA	0.236	0.763	2.901E-16	297	0.067	0.226	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:4yc3A	0.226	0.714	3.206E-16	295	0.070	0.237	4yc3A.pdb.gz
17	PDB:3c4wB	0.241	0.453	5.841E-16	519	0.064	0.123	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
18	PDB:5x3fB	0.242	0.648	9.160E-16	349	0.065	0.186	5x3fB.pdb.gz
19	PDB:1unlA	0.239	0.775	9.629E-16	292	0.069	0.236	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:3mi9A	0.244	0.702	1.012E-15	329	0.082	0.249	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IIN0	0.0	1417	1121	0.735	0.657	A0A0R4IIN0_DANRE Serine/threonine-protein kinase TAO2 isoform X4 OS=Danio rerio OX=7955 GN=taok2b PE=4 SV=2
2	E1BHE1	0.0	1277	874	0.639	0.732	E1BHE1_BOVIN TAO kinase 3 OS=Bos taurus OX=9913 GN=TAOK3 PE=4 SV=2
3	O88664	0.0	2053	1001	0.989	0.989	TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus OX=10116 GN=Taok1 PE=1 SV=1
4	P46549	0.0	632	982	0.367	0.374	SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans OX=6239 GN=kin-18 PE=1 SV=1
5	Q5F2E8	0.0	2065	1001	0.994	0.994	TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus OX=10090 GN=Taok1 PE=1 SV=1
6	Q6ZQ29	0.0	1054	1240	0.538	0.435	TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus OX=10090 GN=Taok2 PE=1 SV=3
7	Q7L7X3	0.0	2076	1001	1.000	1.000	TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens OX=9606 GN=TAOK1 PE=1 SV=1
8	Q9H2K8	0.0	1319	898	0.661	0.737	TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2
9	Q9JLS3	0.0	1044	1235	0.541	0.439	TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus OX=10116 GN=Taok2 PE=1 SV=1
10	Q9UL54	0.0	1048	1235	0.540	0.438	TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens OX=9606 GN=TAOK2 PE=1 SV=2
11	X1WD79	0.0	1417	1138	0.719	0.633	X1WD79_DANRE Serine/threonine-protein kinase TAO2 isoform X2 OS=Danio rerio OX=7955 GN=taok2a PE=1 SV=1
12	Q0KHQ5	2.86e-178	548	1039	0.251	0.242	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
13	O24527	1.45e-73	262	836	0.132	0.158	SIK1_ARATH Serine/threonine-protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SIK1 PE=1 SV=1
14	O61125	6.20e-72	248	461	0.125	0.271	STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum OX=44689 GN=krsA PE=1 SV=1
15	Q5U0E6	2.89e-69	239	431	0.135	0.313	Q5U0E6_HUMAN Epididymis secretory protein Li 95 OS=Homo sapiens OX=9606 GN=HEL-S-95 PE=2 SV=1
16	Q9JI11	4.22e-69	241	487	0.125	0.257	STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Stk4 PE=1 SV=1
17	Q9Y6E0	4.23e-69	239	443	0.135	0.305	STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1
18	Q13043	4.95e-69	241	487	0.125	0.257	STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2
19	D4A648	7.49e-69	240	488	0.130	0.266	D4A648_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Stk4 PE=1 SV=2
20	B0LT89	1.44e-68	238	431	0.133	0.309	STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus OX=10116 GN=Stk24 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	14	17.0	Phosphotransferase enzyme family
2	PF19564 DUF6086	2.9e+02	12.9	Family of unknown function (DUF6086)
3	PF00069 Pkinase	4e-61	218.3	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	1.3e-40	150.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261716

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345083	0.934	Dual specificity mitogen-activated protein kinase kinase 3
2	9606.ENSP00000468348	0.918	Dual specificity mitogen-activated protein kinase kinase 6
3	9606.ENSP00000278616	0.917	Serine-protein kinase ATM
4	9606.ENSP00000376317	0.903	Serine/threonine-protein kinase TAO3
5	9606.ENSP00000310094	0.902	Serine/threonine-protein kinase TAO2
6	9606.ENSP00000404860	0.811	Schwannomin interacting protein 1, isoform CRA_c
7	9606.ENSP00000478927	0.806	Transcriptional coactivator YAP1
8	9606.ENSP00000482609	0.788	Peroxisome assembly protein 12
9	9606.ENSP00000427772	0.714	Protein KIBRA
10	9606.ENSP00000362372	0.701	Bromodomain and WD repeat-containing protein 3
11	9606.ENSP00000325748	0.698	Serine/threonine-protein kinase 25
12	9606.ENSP00000302327	0.674	Pygopus homolog 1
13	9606.ENSP00000356579	0.668	Centrosome-associated protein 350
14	9606.ENSP00000357722	0.668	Protein S100-A8
15	9606.ENSP00000284268	0.661	Progressive ankylosis protein homolog
16	9606.ENSP00000308741	0.644	Circadian locomoter output cycles protein kaput
17	9606.ENSP00000354686	0.630	Zinc finger protein 652
18	9606.ENSP00000185206	0.609	Chloride intracellular channel protein 5
19	9606.ENSP00000330442	0.609	Phospholipase B1, membrane-associated
20	9606.ENSP00000298159	0.589	Cofilin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0019887	0.998	protein kinase regulator activity
GO:0008092	0.997	cytoskeletal protein binding
GO:0019209	0.995	kinase activator activity
GO:0043539	0.992	protein serine/threonine kinase activator activity
GO:0019899	0.637	enzyme binding
GO:0019900	0.566	kinase binding
GO:0019901	0.551	protein kinase binding
GO:0015631	0.513	tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0032501	0.912	multicellular organismal process
GO:0048856	0.905	anatomical structure development
GO:0008152	0.888	metabolic process
GO:0007275	0.887	multicellular organism development
GO:0044237	0.879	cellular metabolic process
GO:0048731	0.868	system development
GO:0007399	0.799	nervous system development
GO:0050896	0.758	response to stimulus
GO:0033043	0.739	regulation of organelle organization
GO:0071704	0.727	organic substance metabolic process
GO:0006793	0.720	phosphorus metabolic process
GO:0044238	0.715	primary metabolic process
GO:0016310	0.657	phosphorylation
GO:0006807	0.635	nitrogen compound metabolic process
GO:0007417	0.598	central nervous system development
GO:0019222	0.585	regulation of metabolic process
GO:0021954	0.582	central nervous system neuron development
GO:0051493	0.580	regulation of cytoskeleton organization
GO:0043170	0.553	macromolecule metabolic process
GO:1901564	0.526	organonitrogen compound metabolic process
GO:0051716	0.515	cellular response to stimulus
GO:0036211	0.506	protein modification process
GO:0023052	0.495	signaling
GO:0007154	0.492	cell communication
GO:0048583	0.482	regulation of response to stimulus
GO:0035556	0.482	intracellular signal transduction
GO:0048518	0.476	positive regulation of biological process
GO:0060255	0.475	regulation of macromolecule metabolic process
GO:0048519	0.459	negative regulation of biological process
GO:0009966	0.457	regulation of signal transduction
GO:0006468	0.454	protein phosphorylation
GO:0080090	0.452	regulation of primary metabolic process
GO:0048523	0.452	negative regulation of cellular process
GO:0048522	0.452	positive regulation of cellular process
GO:0051171	0.451	regulation of nitrogen compound metabolic process
GO:0031323	0.450	regulation of cellular metabolic process
GO:0032886	0.405	regulation of microtubule-based process
GO:1902531	0.322	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.998	intracellular organelle
GO:0005829	0.998	cytosol
GO:0031982	0.985	vesicle
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0005576	0.974	extracellular region
GO:0043230	0.918	extracellular organelle
GO:0005615	0.907	extracellular space
GO:1903561	0.900	extracellular vesicle
GO:0043231	0.882	intracellular membrane-bounded organelle
GO:0005634	0.801	nucleus
GO:0070062	0.711	extracellular exosome
GO:0005856	0.542	cytoskeleton
GO:0016020	0.464	membrane
GO:0015630	0.367	microtubule cytoskeleton
GO:0048471	0.332	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]