StarFunc result for job id Q7L804

User Input

>input (512 residues)
MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVW
KEEASFELPGLLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF
RLESKQGKRIKNRGEIKVNIQFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKNDGTF
SDTSSAIIPSTHMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEK
LKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMNQPDSIVDEGELCFGRQ
NDPFTNVTASLPQKFATLPRKKNPFEESSETWDSSMNLFSKPIEIRKENKREKREKVSLF
ERVTGKKDSRRSDKLNNGGSDSPCDLKSPNAFSENRQDYFDYESTNPFTAKFRASNIMPS
SSFHMSPTSNEDLRKIPDSNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDY
IDNLLVRVMEETPSILRVPYEPSRKAGKFSNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZD48	0.439	0.439	5.406E-68	512	0.934	0.934	D3ZD48.pdb.gz	D3ZD48_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=3
2	AFDB:A0A0R4ID81	0.353	0.374	1.406E-41	478	0.543	0.582	A0A0R4ID81.pdb.gz	A0A0R4ID81_DANRE RAB11 family-interacting protein 2 (class I) OS=Danio rerio OX=7955 GN=rab11fip2 PE=4 SV=1
3	AFDB:Q8R361	0.284	0.228	3.054E-26	645	0.363	0.288	Q8R361.pdb.gz	RFIP5_MOUSE Rab11 family-interacting protein 5 OS=Mus musculus OX=10090 GN=Rab11fip5 PE=1 SV=2
4	AFDB:Q6WKZ4	0.310	0.130	2.949E-25	1283	0.340	0.136	Q6WKZ4.pdb.gz	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
5	AFDB:A2VEG3	0.201	0.124	1.447E-8	851	0.152	0.092	A2VEG3.pdb.gz	A2VEG3_DROME IP16294p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8671 PE=2 SV=1
6	PDB:5a50A	0.212	0.607	1.740E-8	165	0.047	0.145	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
7	AFDB:Q4KWH5	0.206	0.069	3.387E-8	1682	0.135	0.041	Q4KWH5.pdb.gz	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
8	PDB:4rj9A	0.200	0.596	1.130E-7	161	0.053	0.168	4rj9A.pdb.gz
9	AFDB:M9PDD2	0.211	0.167	1.179E-7	655	0.152	0.119	M9PDD2.pdb.gz	M9PDD2_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.182 PE=3 SV=1
10	PDB:5a52A	0.202	0.623	1.339E-7	154	0.045	0.149	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
11	AFDB:Q4KWH8	0.209	0.071	1.397E-7	1693	0.139	0.042	Q4KWH8.pdb.gz	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
12	PDB:5iz5B	0.196	0.138	2.230E-7	746	0.057	0.039	5iz5B.pdb.gz
13	PDB:1cjyA	0.200	0.164	2.360E-7	633	0.055	0.044	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	AFDB:A2AP18	0.200	0.073	3.090E-7	1501	0.182	0.062	A2AP18.pdb.gz	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
15	PDB:5ixcA	0.198	0.150	3.316E-7	684	0.049	0.037	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:3nsjA	0.195	0.189	3.931E-7	530	0.047	0.045	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
17	AFDB:B0G181	0.201	0.116	8.100E-7	968	0.156	0.083	B0G181.pdb.gz	B0G181_DICDI Dilute domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291396 PE=4 SV=1
18	PDB:5iz5A	0.198	0.137	8.214E-7	757	0.051	0.034	5iz5A.pdb.gz
19	PDB:3pfqA	0.157	0.154	9.736E-7	523	0.043	0.042	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
20	PDB:5izrC	0.191	0.150	3.795E-6	659	0.047	0.036	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A5U7	0.0	984	522	0.924	0.906	A0A8I6A5U7_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=1
2	A0A8I6A6W2	0.0	986	510	0.924	0.927	A0A8I6A6W2_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=1
3	A0A8I6A8W0	0.0	988	557	0.926	0.851	A0A8I6A8W0_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=1
4	A0A8I6AF99	0.0	996	512	0.934	0.934	A0A8I6AF99_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=1
5	A0A8I6ASH5	0.0	985	507	0.924	0.933	A0A8I6ASH5_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=1
6	D3ZD48	0.0	985	529	0.924	0.894	D3ZD48_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=3
7	G3XA57	0.0	992	512	0.934	0.934	RFIP2_MOUSE Rab11 family-interacting protein 2 OS=Mus musculus OX=10090 GN=Rab11fip2 PE=1 SV=1
8	Q7L804	0.0	1055	512	1.000	1.000	RFIP2_HUMAN Rab11 family-interacting protein 2 OS=Homo sapiens OX=9606 GN=RAB11FIP2 PE=1 SV=1
9	A0A0R4ID81	3.94e-168	485	478	0.545	0.584	A0A0R4ID81_DANRE RAB11 family-interacting protein 2 (class I) OS=Danio rerio OX=7955 GN=rab11fip2 PE=4 SV=1
10	Q6WKZ4	3.58e-72	251	1283	0.230	0.092	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
11	Q8R361	5.12e-58	205	645	0.209	0.166	RFIP5_MOUSE Rab11 family-interacting protein 5 OS=Mus musculus OX=10090 GN=Rab11fip5 PE=1 SV=2
12	Q9BXF6	7.89e-58	205	653	0.207	0.162	RFIP5_HUMAN Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1
13	A0A1B0GTL5	2.25e-56	205	1324	0.205	0.079	A0A1B0GTL5_HUMAN RAB11 family interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1
14	Q494I2	4.51e-30	124	409	0.143	0.178	Q494I2_DROME GH05001p OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
15	X2JEA7	5.88e-30	123	420	0.143	0.174	X2JEA7_DROME Rab11 interacting protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
16	X2JFP6	3.98e-29	124	815	0.143	0.090	X2JFP6_DROME Rab11 interacting protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
17	X2JL40	4.88e-29	124	826	0.143	0.088	X2JL40_DROME Rab11 interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
18	Q9VWS3	6.01e-29	123	832	0.143	0.088	Q9VWS3_DROME Rab11 interacting protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
19	E7EX40	3.38e-17	86.7	501	0.074	0.076	E7EX40_HUMAN RAB11 family interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=1
20	Q66VB0	4.91e-09	61.6	1086	0.086	0.041	Q66VB0_ORYSJ No pollen OS=Oryza sativa subsp. japonica OX=39947 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2e-15	68.3	C2 domain
2	PF09457 RBD-FIP	4.3e-14	63.5	FIP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347839

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261890	0.999	Ras-related protein Rab-11A
2	9606.ENSP00000285039	0.999	Unconventional myosin-Vb
3	9606.ENSP00000479153	0.992	EH domain-containing protein 1
4	9606.ENSP00000354376	0.982	Ras-related protein Rab-25
5	9606.ENSP00000333547	0.979	Ras-related protein Rab-11B
6	9606.ENSP00000199280	0.939	Aquaporin-2
7	9606.ENSP00000258098	0.915	Rab11 family-interacting protein 5
8	9606.ENSP00000327116	0.897	EH domain-containing protein 3
9	9606.ENSP00000392065	0.891	RalBP1-associated Eps domain-containing protein 1
10	9606.ENSP00000331342	0.874	Rab11 family-interacting protein 1
11	9606.ENSP00000262305	0.810	Rab11 family-interacting protein 3
12	9606.ENSP00000482620	0.796	Rab11 family-interacting protein 4
13	9606.ENSP00000253699	0.744	Rabenosyn-5
14	9606.ENSP00000385751	0.736	Serine/threonine-protein kinase MARK2
15	9606.ENSP00000360798	0.734	Epidermal growth factor receptor substrate 15
16	9606.ENSP00000296582	0.708	Transmembrane protein 184C
17	9606.ENSP00000357440	0.707	Heat shock factor protein 2
18	9606.ENSP00000382670	0.680	Glutaredoxin domain-containing cysteine-rich protein 1
19	9606.ENSP00000368022	0.667	Optineurin
20	9606.ENSP00000331748	0.637	Ras-related protein Rab-12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	0.998	protein dimerization activity
GO:0019899	0.996	enzyme binding
GO:0042802	0.994	identical protein binding
GO:0019900	0.994	kinase binding
GO:0042803	0.851	protein homodimerization activity
GO:0019901	0.720	protein kinase binding
GO:0043167	0.553	ion binding
GO:0051020	0.378	GTPase binding
GO:0031267	0.369	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0032879	0.919	regulation of localization
GO:0048522	0.915	positive regulation of cellular process
GO:0032880	0.911	regulation of protein localization
GO:1905475	0.875	regulation of protein localization to membrane
GO:1904375	0.875	regulation of protein localization to cell periphery
GO:1905477	0.858	positive regulation of protein localization to membrane
GO:1904377	0.858	positive regulation of protein localization to cell periphery
GO:0009987	0.781	cellular process
GO:1903076	0.751	regulation of protein localization to plasma membrane
GO:1903078	0.680	positive regulation of protein localization to plasma membrane
GO:0051179	0.536	localization
GO:0051234	0.438	establishment of localization
GO:0006810	0.376	transport
GO:0051641	0.357	cellular localization
GO:0050896	0.309	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.999	endomembrane system
GO:0031982	0.999	vesicle
GO:0005886	0.999	plasma membrane
GO:0005634	0.995	nucleus
GO:0031981	0.988	nuclear lumen
GO:0030659	0.988	cytoplasmic vesicle membrane
GO:0005768	0.978	endosome
GO:0005654	0.973	nucleoplasm
GO:0005576	0.882	extracellular region
GO:0005829	0.846	cytosol
GO:0005615	0.816	extracellular space
GO:0098588	0.584	bounding membrane of organelle
GO:0010008	0.436	endosome membrane
GO:0001891	0.352	phagocytic cup
GO:0070062	0.302	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]