StarFunc result for job id Q7L8A9

User Input

>input (365 residues)
MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPF
FVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPE
RLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLT
NSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELV
LDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARD
MRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPDLNG
YQIRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C1W1	0.801	0.780	2.480E-60	375	0.937	0.912	Q8C1W1.pdb.gz	VASH1_MOUSE Tubulinyl-Tyr carboxypeptidase 1 OS=Mus musculus OX=10090 GN=Vash1 PE=1 SV=4
2	PDB:6k81A	0.666	0.991	7.761E-46	245	0.668	0.996	6k81A.pdb.gz	Structural insights into tubulin detyrosination by vasohibins-SVBP complex.
3	AFDB:Q86V25	0.701	0.721	6.889E-41	355	0.501	0.515	Q86V25.pdb.gz	VASH2_HUMAN Tubulinyl-Tyr carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=VASH2 PE=1 SV=2
4	PDB:6jzcB	0.662	0.952	2.938E-35	253	0.416	0.601	6jzcB.pdb.gz
5	AFDB:Q387E4	0.516	0.391	5.624E-19	487	0.192	0.144	Q387E4.pdb.gz	Q387E4_TRYB2 Vasohibin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0040 PE=4 SV=1
6	PDB:2pqtA	0.184	0.223	1.622E-2	295	0.052	0.064	2pqtA.pdb.gz
7	AFDB:O87990	0.192	0.180	4.733E-2	393	0.112	0.104	O87990.pdb.gz	O87990_BORBO Putative secreted protein OS=Bordetella bronchiseptica OX=518 GN=BbLPS1.17c PE=4 SV=1
8	PDB:1w4tA	0.202	0.253	4.882E-2	277	0.041	0.054	1w4tA.pdb.gz
9	PDB:2pfrA	0.205	0.252	5.482E-2	290	0.066	0.083	2pfrA.pdb.gz	The Crystal Structure of Human N-acetyltransferase 2 in complex with CoA
10	AFDB:Q9VHV1	0.106	0.067	8.957E-2	737	0.079	0.039	Q9VHV1.pdb.gz	POLI_DROME DNA polymerase iota OS=Drosophila melanogaster OX=7227 GN=PolI PE=1 SV=1
11	PDB:7et3M	0.108	0.089	1.100E-1	468	0.066	0.051	7et3M.pdb.gz	Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
12	AFDB:Q8H1D4	0.080	0.081	1.695E-1	355	0.104	0.107	Q8H1D4.pdb.gz	DRB4_ARATH Double-stranded RNA-binding protein 4 OS=Arabidopsis thaliana OX=3702 GN=DBR4 PE=1 SV=1
13	AFDB:Q9XXH8	0.121	0.065	2.265E-1	826	0.071	0.031	Q9XXH8.pdb.gz	CNT1_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 OS=Caenorhabditis elegans OX=6239 GN=cnt-1 PE=1 SV=2
14	PDB:6u426U	0.155	0.106	3.716E-1	569	0.058	0.037	6u426U.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
15	PDB:6wxuB	0.099	0.124	3.716E-1	273	0.052	0.070	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
16	PDB:3mh9A	0.067	0.097	4.173E-1	205	0.027	0.049	3mh9A.pdb.gz
17	PDB:6pgvA	0.135	0.238	4.687E-1	152	0.058	0.138	6pgvA.pdb.gz	Structural insights into the activity and regulation of human Josephin-2
18	AFDB:P53955	0.099	0.066	6.072E-1	656	0.093	0.052	P53955.pdb.gz	SLM2_YEAST Phosphatidylinositol 4,5-bisphosphate-binding protein SLM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLM2 PE=1 SV=1
19	AFDB:Q63537	0.111	0.076	8.114E-1	586	0.137	0.085	Q63537.pdb.gz	SYN2_RAT Synapsin-2 OS=Rattus norvegicus OX=10116 GN=Syn2 PE=1 SV=1
20	AFDB:Q8N6S4	0.080	0.060	9.656E-1	541	0.074	0.050	Q8N6S4.pdb.gz	AN13C_HUMAN Ankyrin repeat domain-containing protein 13C OS=Homo sapiens OX=9606 GN=ANKRD13C PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7L8A9	0.0	751	365	1.000	1.000	VASH1_HUMAN Tubulinyl-Tyr carboxypeptidase 1 OS=Homo sapiens OX=9606 GN=VASH1 PE=1 SV=1
2	Q8C1W1	0.0	657	375	0.932	0.907	VASH1_MOUSE Tubulinyl-Tyr carboxypeptidase 1 OS=Mus musculus OX=10090 GN=Vash1 PE=1 SV=4
3	Q86V25	1.97e-129	377	355	0.504	0.518	VASH2_HUMAN Tubulinyl-Tyr carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=VASH2 PE=1 SV=2
4	Q8C5G2	8.56e-128	372	355	0.501	0.515	VASH2_MOUSE Tubulinyl-Tyr carboxypeptidase 2 OS=Mus musculus OX=10090 GN=Vash2 PE=1 SV=2
5	Q387E4	7.76e-31	124	487	0.189	0.142	Q387E4_TRYB2 Vasohibin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0040 PE=4 SV=1
6	Q0T963	0.27	35.8	3242	0.112	0.013	CDIA_ECOL5 tRNA nuclease CdiA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=cdiA PE=1 SV=1
7	P20050	2.9	32.3	605	0.060	0.036	HOP1_YEAST Meiosis-specific protein HOP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOP1 PE=1 SV=2
8	Q8NF50	3.0	32.7	2099	0.052	0.009	DOCK8_HUMAN Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8 PE=1 SV=3
9	P34474	3.1	32.3	431	0.082	0.070	HLH11_CAEEL Helix-loop-helix protein 11 OS=Caenorhabditis elegans OX=6239 GN=hlh-11 PE=1 SV=3
10	A0A1D8PJJ7	4.1	32.0	838	0.038	0.017	A0A1D8PJJ7_CANAL Zcf1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ZCF1 PE=4 SV=1
11	O94782	4.2	32.0	785	0.088	0.041	UBP1_HUMAN Ubiquitin carboxyl-terminal hydrolase 1 OS=Homo sapiens OX=9606 GN=USP1 PE=1 SV=1
12	Q8C147	5.2	32.0	2100	0.055	0.010	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
13	A0A178WMH3	8.1	29.6	129	0.027	0.078	A0A178WMH3_ARATH Dynein light chain OS=Arabidopsis thaliana OX=3702 GN=At1g23220 PE=1 SV=1
14	Q6P2U5	8.9	30.0	175	0.063	0.131	Q6P2U5_DANRE ADP-ribosylation factor 6 OS=Danio rerio OX=7955 GN=arf6b PE=1 SV=1
15	P26990	9.8	30.0	175	0.063	0.131	ARF6_CHICK ADP-ribosylation factor 6 OS=Gallus gallus OX=9031 GN=ARF6 PE=2 SV=3
16	G3N3N1	9.9	30.0	175	0.063	0.131	G3N3N1_BOVIN ADP-ribosylation factor 6 OS=Bos taurus OX=9913 GN=ARF6 PE=3 SV=1
17	P62330	9.9	30.0	175	0.063	0.131	ARF6_HUMAN ADP-ribosylation factor 6 OS=Homo sapiens OX=9606 GN=ARF6 PE=1 SV=2
18	P62331	9.9	30.0	175	0.063	0.131	ARF6_MOUSE ADP-ribosylation factor 6 OS=Mus musculus OX=10090 GN=Arf6 PE=1 SV=2
19	P62332	9.9	30.0	175	0.063	0.131	ARF6_RAT ADP-ribosylation factor 6 OS=Rattus norvegicus OX=10116 GN=Arf6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14822 Vasohibin	1.5e-123	422.4	Vasohibin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000167106

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361599	0.999	Small vasohibin-binding protein
2	9606.ENSP00000301071	0.981	Tubulin alpha-1A chain
3	9606.ENSP00000264071	0.924	Tubulin beta-4A chain
4	9606.ENSP00000369703	0.912	Tubulin beta-2A chain
5	9606.ENSP00000336799	0.909	Tubulin alpha-1B chain
6	9606.ENSP00000301072	0.903	Tubulin alpha-1C chain
7	9606.ENSP00000318197	0.903	Tubulin alpha-3E chain
8	9606.ENSP00000217133	0.901	Tubulin beta-1 chain
9	9606.ENSP00000259818	0.901	Tubulin beta-2B chain
10	9606.ENSP00000309431	0.901	Tubulin beta-8 chain-like protein LOC260334
11	9606.ENSP00000318697	0.901	Tubulin beta-6 chain
12	9606.ENSP00000341289	0.901	Tubulin beta-4B chain
13	9606.ENSP00000456206	0.901	Tubulin beta-8 chain
14	9606.ENSP00000320295	0.803	Tubulin beta-3 chain
15	9606.ENSP00000251089	0.773	Angel homolog 1
16	9606.ENSP00000233336	0.610	Tubulin--tyrosine ligase
17	9606.ENSP00000261534	0.604	Protein O-mannosyl-transferase 2
18	9606.ENSP00000478570	0.528	Vascular endothelial growth factor A
19	9606.ENSP00000238682	0.517	Transforming growth factor beta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0004181	1.000	metallocarboxypeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0051239	0.987	regulation of multicellular organismal process
GO:0045765	0.977	regulation of angiogenesis
GO:0050794	0.975	regulation of cellular process
GO:0071704	0.971	organic substance metabolic process
GO:0044238	0.965	primary metabolic process
GO:0007275	0.965	multicellular organism development
GO:0048731	0.957	system development
GO:0006807	0.955	nitrogen compound metabolic process
GO:0043170	0.952	macromolecule metabolic process
GO:0072359	0.952	circulatory system development
GO:0019538	0.939	protein metabolic process
GO:0051241	0.936	negative regulation of multicellular organismal process
GO:0001944	0.933	vasculature development
GO:0009987	0.919	cellular process
GO:1901343	0.900	negative regulation of vasculature development
GO:0001568	0.869	blood vessel development
GO:2000181	0.865	negative regulation of blood vessel morphogenesis
GO:0042127	0.805	regulation of cell population proliferation
GO:0048523	0.742	negative regulation of cellular process
GO:0016525	0.723	negative regulation of angiogenesis
GO:0006508	0.669	proteolysis
GO:0050678	0.663	regulation of epithelial cell proliferation
GO:0048513	0.652	animal organ development
GO:0040012	0.619	regulation of locomotion
GO:0050896	0.570	response to stimulus
GO:0048518	0.532	positive regulation of biological process
GO:0009653	0.518	anatomical structure morphogenesis
GO:0001936	0.512	regulation of endothelial cell proliferation
GO:0010632	0.506	regulation of epithelial cell migration
GO:0060711	0.496	labyrinthine layer development
GO:0019222	0.464	regulation of metabolic process
GO:0048522	0.457	positive regulation of cellular process
GO:0010594	0.435	regulation of endothelial cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005615	0.986	extracellular space
GO:0031982	0.881	vesicle
GO:0005783	0.852	endoplasmic reticulum
GO:0043232	0.849	intracellular non-membrane-bounded organelle
GO:0045177	0.727	apical part of cell
GO:0005829	0.654	cytosol
GO:0065010	0.442	extracellular membrane-bounded organelle
GO:1903561	0.340	extracellular vesicle
GO:0015630	0.339	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.17.-	1.000	Metallocarboxypeptidases.

[back to server]