StarFunc result for job id Q7L985

User Input

>input (606 residues)
MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETK
ILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLV
PLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLE
QLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDM
MPANSLYGLNLTSLSVTNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQ
ELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACD
CRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHL
LVDEGQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGM
YVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKT
ILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRR
FNMKMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3URE9	0.974	0.974	2.543E-95	606	0.975	0.975	Q3URE9.pdb.gz	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
2	AFDB:F8W4D7	0.817	0.801	1.558E-71	619	0.583	0.570	F8W4D7.pdb.gz
3	AFDB:A0A286YAB9	0.816	0.788	8.153E-70	628	0.639	0.616	A0A286YAB9.pdb.gz
4	AFDB:Q66HV9	0.910	0.887	5.606E-68	622	0.571	0.556	Q66HV9.pdb.gz	LIG1B_DANRE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B OS=Danio rerio OX=7955 GN=lingo1b PE=1 SV=1
5	AFDB:Q96FE5	0.865	0.847	6.076E-66	620	0.602	0.589	Q96FE5.pdb.gz	LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=LINGO1 PE=1 SV=2
6	AFDB:Q149C3	0.785	0.801	8.652E-51	593	0.413	0.422	Q149C3.pdb.gz	LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus OX=10090 GN=Lingo4 PE=2 SV=2
7	AFDB:Q8C031	0.333	0.319	8.531E-31	640	0.267	0.253	Q8C031.pdb.gz	LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2
8	AFDB:Q503I7	0.339	0.322	7.574E-30	647	0.279	0.261	Q503I7.pdb.gz	Q503I7_DANRE Leucine rich repeat containing 4C isoform X1 OS=Danio rerio OX=7955 GN=zgc:110565 PE=1 SV=1
9	AFDB:O75325	0.544	0.470	9.951E-30	713	0.223	0.189	O75325.pdb.gz	LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens OX=9606 GN=LRRN2 PE=2 SV=2
10	AFDB:Q61809	0.548	0.471	1.368E-29	716	0.281	0.237	Q61809.pdb.gz	LRRN1_MOUSE Leucine-rich repeat neuronal protein 1 OS=Mus musculus OX=10090 GN=Lrrn1 PE=2 SV=1
11	PDB:6gffI	0.403	0.437	3.053E-12	551	0.177	0.194	6gffI.pdb.gz
12	PDB:1xcdA	0.309	0.591	1.370E-11	305	0.132	0.262	1xcdA.pdb.gz
13	PDB:2ft3F	0.405	0.754	6.148E-11	305	0.129	0.256	2ft3F.pdb.gz
14	PDB:7wv3A	0.194	0.178	8.847E-11	668	0.150	0.136	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
15	PDB:3t6qA	0.211	0.212	9.689E-11	601	0.160	0.161	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:7wrqA	0.431	0.458	1.216E-10	566	0.167	0.178	7wrqA.pdb.gz
17	PDB:7tvfD	0.276	0.316	3.793E-10	515	0.160	0.188	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
18	PDB:3b2dA	0.234	0.236	1.626E-9	601	0.165	0.166	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
19	PDB:5yq5B	0.365	0.645	1.511E-8	306	0.145	0.288	5yq5B.pdb.gz
20	PDB:6hkwA	0.360	0.648	7.096E-8	306	0.130	0.258	6hkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3URE9	0.0	1227	606	0.977	0.977	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
2	Q66HV9	0.0	679	622	0.571	0.556	LIG1B_DANRE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B OS=Danio rerio OX=7955 GN=lingo1b PE=1 SV=1
3	Q96FE5	0.0	733	620	0.602	0.589	LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=LINGO1 PE=1 SV=2
4	Q9D1T0	0.0	729	614	0.599	0.591	LIGO1_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Mus musculus OX=10090 GN=Lingo1 PE=1 SV=1
5	Q149C3	1.72e-150	448	593	0.403	0.411	LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus OX=10090 GN=Lingo4 PE=2 SV=2
6	P0C192	2.43e-47	179	709	0.239	0.205	LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus OX=10090 GN=Lrrc4b PE=1 SV=1
7	P0CC10	2.84e-47	179	709	0.239	0.205	LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1
8	Q503I7	9.84e-47	176	647	0.246	0.230	Q503I7_DANRE Leucine rich repeat containing 4C isoform X1 OS=Danio rerio OX=7955 GN=zgc:110565 PE=1 SV=1
9	Q8C031	2.87e-46	175	640	0.244	0.231	LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2
10	Q9NT99	5.03e-46	175	713	0.231	0.196	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3
11	Q9HCJ2	5.11e-46	174	640	0.243	0.230	LRC4C_HUMAN Leucine-rich repeat-containing protein 4C OS=Homo sapiens OX=9606 GN=LRRC4C PE=1 SV=1
12	Q9HBW1	1.00e-42	165	653	0.224	0.208	LRRC4_HUMAN Leucine-rich repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=LRRC4 PE=1 SV=2
13	Q99PH1	1.48e-41	161	652	0.224	0.209	LRRC4_MOUSE Leucine-rich repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Lrrc4 PE=1 SV=2
14	Q45R42	2.71e-41	160	652	0.223	0.207	LRRC4_RAT Leucine-rich repeat-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrrc4 PE=1 SV=1
15	O75325	3.66e-41	161	713	0.231	0.196	LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens OX=9606 GN=LRRN2 PE=2 SV=2
16	Q61809	2.08e-40	159	716	0.243	0.205	LRRN1_MOUSE Leucine-rich repeat neuronal protein 1 OS=Mus musculus OX=10090 GN=Lrrn1 PE=2 SV=1
17	Q9ESY6	5.38e-40	157	707	0.236	0.202	LRRN3_RAT Leucine-rich repeat neuronal protein 3 OS=Rattus norvegicus OX=10116 GN=Lrrn3 PE=2 SV=1
18	E9QDQ3	1.78e-39	157	858	0.231	0.163	E9QDQ3_DANRE Leucine-rich repeat-containing 4.1 OS=Danio rerio OX=7955 GN=lrrc4.1 PE=4 SV=2
19	Q6UXK5	3.95e-39	155	716	0.239	0.203	LRRN1_HUMAN Leucine-rich repeat neuronal protein 1 OS=Homo sapiens OX=9606 GN=LRRN1 PE=1 SV=1
20	Q6P1C6	1.22e-38	155	1117	0.271	0.147	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	1.9e+02	13.5	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	2.8e-13	61.1	Immunoglobulin I-set domain
3	PF00047 ig	2.1e-05	36.0	Immunoglobulin domain
4	PF13895 Ig_2	0.0017	30.0	Immunoglobulin domain
5	PF13927 Ig_3	8.8e-12	56.7	Immunoglobulin domain
6	PF16681 Ig_5	3.9e+02	12.9	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
7	PF18452 Ig_6	3.2e+02	12.6	Immunoglobulin domain
8	PF17736 Ig_C17orf99	3.6e+02	12.6	C17orf99 Ig domain
9	PF01462 LRRNT	0.62	21.0	Leucine rich repeat N-terminal domain
10	PF00560 LRR_1	2.2e-06	38.2	Leucine Rich Repeat
11	PF12799 LRR_4	3.9e-17	73.3	Leucine Rich repeats (2 copies)
12	PF13306 LRR_5	3.6e-23	93.3	BspA type Leucine rich repeat region (6 copies)
13	PF13855 LRR_8	9.5e-60	209.6	Leucine rich repeat
14	PF14580 LRR_9	37	15.3	Leucine-rich repeat
15	PF07686 V-set	2.4	19.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369328

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262244	0.833	MOB kinase activator 3B
2	9606.ENSP00000263780	0.684	Charged multivesicular body protein 2b
3	9606.ENSP00000482753	0.682	Guanine nucleotide exchange C9orf72
4	9606.ENSP00000223500	0.674	Charged multivesicular body protein 5
5	9606.ENSP00000380598	0.674	Biogenesis of lysosome-related organelles complex 1 subunit 5
6	9606.ENSP00000410216	0.653	Centrosomal protein POC5
7	9606.ENSP00000296721	0.642	Actin filament-associated protein 1-like 1
8	9606.ENSP00000276943	0.636	Interferon kappa
9	9606.ENSP00000370508	0.635	Translation initiation factor IF-3, mitochondrial
10	9606.ENSP00000274569	0.626	Prenylcysteine oxidase-like
11	9606.ENSP00000296679	0.626	WD repeat-containing protein 41
12	9606.ENSP00000385025	0.623	Guanine nucleotide exchange protein SMCR8
13	9606.ENSP00000285071	0.620	Folliculin
14	9606.ENSP00000322251	0.620	Serine/threonine-protein kinase TNNI3K
15	9606.ENSP00000264711	0.607	DnaJ homolog subfamily C member 27
16	9606.ENSP00000253047	0.602	Transmembrane protein 160
17	9606.ENSP00000349575	0.600	MOB kinase activator 3A
18	9606.ENSP00000308610	0.596	Glycerol-3-phosphate dehydrogenase, mitochondrial
19	9606.ENSP00000354536	0.596	Astrotactin-1
20	9606.ENSP00000369176	0.596	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0050896	0.542	response to stimulus
GO:0051239	0.531	regulation of multicellular organismal process
GO:2000026	0.507	regulation of multicellular organismal development
GO:0048518	0.498	positive regulation of biological process
GO:0051716	0.440	cellular response to stimulus
GO:0032501	0.419	multicellular organismal process
GO:0032502	0.410	developmental process
GO:0051960	0.395	regulation of nervous system development
GO:0048856	0.387	anatomical structure development
GO:0007275	0.382	multicellular organism development
GO:0048522	0.359	positive regulation of cellular process
GO:0048731	0.327	system development
GO:0071840	0.319	cellular component organization or biogenesis
GO:0051128	0.305	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005622	0.667	intracellular anatomical structure
GO:0005737	0.488	cytoplasm
GO:0043226	0.410	organelle
GO:0032991	0.315	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]