StarFunc result for job id Q7LBC6

User Input

>input (1761 residues)
MADAAASPVGKRLLLLFADTAASASASAPAAAAASGDPGPALRTRAWRAGTVRAMSGAVP
QDLAIFVEFDGCNWKQHSWVKVHAEEVIVLLLEGSLVWAPREDPVLLQGIRVSIAQWPAL
TFTPLVDKLGLGSVVPVEYLLDRELRFLSDANGLHLFQMGTDSQNQILLEHAALRETVNA
LISDQKLQEIFSRGPYSVQGHRVKIYQPEGEEGWLYGVVSHQDSITRLMEVSVTESGEIK
SVDPRLIHVMLMDNSAPQSEGGTLKAVKSSKGKKKRESIEGKDGRRRKSASDSGCDPASK
KLKGDRGEVDSNGSDGGEASRGPWKGGNASGEPGLDQRAKQPPSTFVPQINRNIRFATYT
KENGRTLVVQDEPVGGDTPASFTPYSTATGQTPLAPEVGGAENKEAGKTLEQVGQGIVAS
AAVVTTASSTPNTVRISDTGLAAGTVPEKQKGSRSQASGENSRNSILASSGFGAPLPSSS
QPLTFGSGRSQSNGVLATENKPLGFSFGCSSAQEAQKDTDLSKNLFFQCMSQTLPTSNYF
TTVSESLADDSSSRDSFKQSLESLSSGLCKGRSVLGTDTKPGSKAGSSVDRKVPAESMPT
LTPAFPRSLLNARTPENHENLFLQPPKLSREEPSNPFLAFVEKVEHSPFSSFASQASGSS
SSATTVTSKVAPSWPESHSSADSASLAKKKPLFITTDSSKLVSGVLGSALTSGGPSLSAM
GNGRSSSPTSSLTQPIEMPTLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSP
ADFSQENKAPFEAVKRFSLDERSLACRQDSDSSTNSDLSDLSDSEEQLQAKTGLKGIPEH
LMGKLGPNGERSAELLLGKSKGKQAPKGRPRTAPLKVGQSVLKDVSKVKKLKQSGEPFLQ
DGSCINVAPHLHKCRECRLERYRKFKEQEQDDSTVACRFFHFRRLIFTRKGVLRVEGFLS
PQQSDPDAMNLWIPSSSLAEGIDLETSKYILANVGDQFCQLVMSEKEAMMMVEPHQKVAW
KRAVRGVREMCDVCETTLFNIHWVCRKCGFGVCLDCYRLRKSRPRSETEEMGDEEVFSWL
KCAKGQSHEPENLMPTQIIPGTALYNIGDMVHAARGKWGIKANCPCISRQNKSVLRPAVT
NGMSQLPSINPSASSGNETTFSGGGGPAPVTTPEPDHVPKADSTDIRSEEPLKTDSSASN
SNSELKAIRPPCPDTAPPSSALHWLADLATQKAKEETKEAGSLRSVLNKESHSPFGLDSF
NSTAKVSPLTPKLFNSLLLGPTASNNKTEGSSLRDLLHSGPGKLPQTPLDTGIPFPPVFS
TSSAGVKSKASLPNFLDHIIASVVENKKTSDASKRACNLTDTQKEVKEMVMGLNVLDPHT
SHSWLCDGRLLCLHDPSNKNNWKIFRECWKQGQPVLVSGVHKKLKSELWKPEAFSQEFGD
QDVDLVNCRNCAIISDVKVRDFWDGFEIICKRLRSEDGQPMVLKLKDWPPGEDFRDMMPT
RFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLH
LDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAK
DAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDA
VFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNII
YHAVKDAVGTLKAHESKLARS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0RDF1	0.441	0.449	0.000	1724	0.913	0.932	M0RDF1.pdb.gz	M0RDF1_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=2
2	AFDB:Q7LBC6	1.000	1.000	0.000	1761	1.000	1.000	Q7LBC6.pdb.gz	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
3	AFDB:A0A0R4IYD2	0.473	0.331	5.171E-102	2557	0.384	0.264	A0A0R4IYD2.pdb.gz
4	AFDB:Q15652	0.399	0.284	1.398E-97	2540	0.390	0.270	Q15652.pdb.gz	JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2
5	AFDB:Q69ZK6	0.364	0.275	7.289E-82	2350	0.301	0.226	Q69ZK6.pdb.gz	JHD2C_MOUSE Probable JmjC domain-containing histone demethylation protein 2C OS=Mus musculus OX=10090 GN=Jmjd1c PE=1 SV=3
6	AFDB:G3V9U4	0.143	0.180	1.886E-10	1356	0.119	0.155	G3V9U4.pdb.gz	G3V9U4_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6b PE=3 SV=4
7	AFDB:E9QG91	0.143	0.146	9.138E-10	1719	0.112	0.115	E9QG91.pdb.gz
8	AFDB:A0A1D5NSI1	0.139	0.125	4.251E-8	1996	0.136	0.120	A0A1D5NSI1.pdb.gz
9	AFDB:Q9GRZ3	0.136	0.145	4.978E-8	1641	0.120	0.129	Q9GRZ3.pdb.gz	DPY21_CAEEL Lysine-specific demethylase 9 OS=Caenorhabditis elegans OX=6239 GN=dpy-21 PE=1 SV=1
10	PDB:3al5B	0.108	0.506	1.066E-6	311	0.024	0.135	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
11	PDB:3al5C	0.105	0.546	1.480E-5	284	0.023	0.144	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
12	PDB:4qszA	0.111	0.260	1.480E-5	686	0.023	0.058	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
13	PDB:5nfnB	0.106	0.508	1.559E-5	318	0.023	0.129	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
14	AFDB:Q9LEY4	0.047	0.056	3.213E-5	1445	0.104	0.127	Q9LEY4.pdb.gz	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1
15	PDB:7yxgA	0.104	0.491	1.578E-4	313	0.028	0.160	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
16	PDB:2ns2B	0.043	0.264	2.281E-4	172	0.020	0.203	2ns2B.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
17	PDB:4b7eA	0.108	0.465	3.127E-4	349	0.024	0.120	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
18	PDB:2ns2A	0.053	0.258	4.288E-4	201	0.019	0.169	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
19	PDB:7okyZ	0.029	0.120	1.242E-2	374	0.011	0.053	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
20	PDB:6tedZ	0.034	0.101	4.628E-2	510	0.015	0.053	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZXX2	0.0	3273	1762	0.934	0.934	A0A8I5ZXX2_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=3 SV=1
2	A0A8I6AC36	0.0	2469	1562	0.693	0.781	A0A8I6AC36_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=1
3	M0RDF1	0.0	3179	1724	0.914	0.933	M0RDF1_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=2
4	Q15652	0.0	860	2540	0.250	0.173	JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2
5	Q63679	0.0	1075	1214	0.299	0.434	KDM3A_RAT Lysine-specific demethylase 3A OS=Rattus norvegicus OX=10116 GN=Kdm3a PE=2 SV=1
6	Q69ZK6	0.0	845	2350	0.244	0.183	JHD2C_MOUSE Probable JmjC domain-containing histone demethylation protein 2C OS=Mus musculus OX=10090 GN=Jmjd1c PE=1 SV=3
7	Q6PCM1	0.0	1070	1323	0.303	0.403	KDM3A_MOUSE Lysine-specific demethylase 3A OS=Mus musculus OX=10090 GN=Kdm3a PE=1 SV=1
8	Q7LBC6	0.0	3632	1761	1.000	1.000	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
9	Q9Y4C1	0.0	1074	1321	0.299	0.398	KDM3A_HUMAN Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4
10	Q9VHC5	2.95e-143	467	854	0.125	0.259	Q9VHC5_DROME JmjC domain-containing histone demethylase 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Kdm3 PE=2 SV=1
11	C0SUU8	3.04e-63	236	875	0.077	0.155	JMJ26_ARATH Lysine-specific demethylase JMJ26 OS=Arabidopsis thaliana OX=3702 GN=JMJ26 PE=2 SV=1
12	C0SV12	1.23e-59	225	883	0.077	0.153	JMJ29_ARATH Lysine-specific demethylase JMJ29 OS=Arabidopsis thaliana OX=3702 GN=JMJ29 PE=2 SV=1
13	Q9SSE9	1.65e-58	223	1027	0.083	0.142	JMJ25_ARATH Lysine-specific demethylase JMJ25 OS=Arabidopsis thaliana OX=3702 GN=JMJ25 PE=1 SV=1
14	F4JFK4	7.39e-53	206	1049	0.082	0.138	F4JFK4_ARATH Transcription factor jumonji (JmjC) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=IBM1 PE=1 SV=1
15	P97609	4.52e-50	197	1181	0.081	0.120	HAIR_RAT Lysine-specific demethylase hairless OS=Rattus norvegicus OX=10116 GN=Hr PE=1 SV=2
16	Q61645	3.54e-49	194	1182	0.080	0.119	HAIR_MOUSE Lysine-specific demethylase hairless OS=Mus musculus OX=10090 GN=Hr PE=2 SV=2
17	O43593	4.32e-49	194	1189	0.080	0.119	HAIR_HUMAN Lysine-specific demethylase hairless OS=Homo sapiens OX=9606 GN=HR PE=1 SV=5
18	Q8VYB9	8.03e-31	134	840	0.038	0.080	JMJ27_ARATH Lysine-specific demethylase JMJ27 OS=Arabidopsis thaliana OX=3702 GN=JMJ27 PE=1 SV=1
19	F4HZD1	2.12e-27	123	944	0.062	0.115	JMJ24_ARATH E3 ubiquitin-protein ligase JMJ24 OS=Arabidopsis thaliana OX=3702 GN=JMJ24 PE=1 SV=1
20	Q8H1S7	2.00e-18	94.7	927	0.025	0.047	JMJ28_ARATH Lysine-specific demethylase JMJ28 OS=Arabidopsis thaliana OX=3702 GN=JMJ28 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03107 C1_2	4.7e+02	12.5	C1 domain
2	PF07883 Cupin_2	4.9e+02	11.9	Cupin domain
3	PF02373 JmjC	1.6e-12	59.2	JmjC domain, hydroxylase
4	PF02928 zf-C5HC2	5.8e+02	12.3	C5HC2 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386660	0.821	Lysine-specific demethylase 3A
2	9606.ENSP00000309591	0.804	cAMP-dependent protein kinase catalytic subunit alpha
3	9606.ENSP00000359719	0.804	cAMP-dependent protein kinase catalytic subunit beta
4	9606.ENSP00000366488	0.804	cAMP-dependent protein kinase catalytic subunit gamma
5	9606.ENSP00000287820	0.803	Peroxisome proliferator-activated receptor gamma
6	9606.ENSP00000352185	0.759	Lysine-specific demethylase PHF2
7	9606.ENSP00000350676	0.719	Histone lysine demethylase PHF8
8	9606.ENSP00000380692	0.717	Lysine-specific demethylase 7A
9	9606.ENSP00000254480	0.713	SWI/SNF complex subunit SMARCC1
10	9606.ENSP00000432786	0.710	Lysine-specific demethylase 2A
11	9606.ENSP00000395654	0.705	Transcription activator BRG1
12	9606.ENSP00000263121	0.704	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
13	9606.ENSP00000267064	0.701	SWI/SNF complex subunit SMARCC2
14	9606.ENSP00000320485	0.697	AT-rich interactive domain-containing protein 1A
15	9606.ENSP00000159111	0.694	Lysine-specific demethylase 4B
16	9606.ENSP00000279873	0.689	AT-rich interactive domain-containing protein 5B
17	9606.ENSP00000344546	0.679	AT-rich interactive domain-containing protein 1B
18	9606.ENSP00000265773	0.678	Probable global transcription activator SNF2L2
19	9606.ENSP00000239906	0.677	Protein FAM53C
20	9606.ENSP00000355969	0.671	Plays a critical role in the regulation of enzymes involved in nucleotide cycle in photoreceptors (PubMed:29515371, PubMed:21928830, PubMed:21078983, PubMed:27471269, PubMed:30559291). Inhibits the basal catalytic activity and the GCAP-stimulated activity of GUCY2D and GUCY2F, two retinal guanylyl cyclases involved in the production of cGMP in photoreceptors (PubMed:21928830, PubMed:27471269, PubMed:29515371, PubMed:30559291). Involved in the transport of GUCY2D and GUCY2F to their target sites in the photoreceptor outer segment . Up-regulates the activity of GUK1, a kinase that plays [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016209	1.000	antioxidant activity
GO:0003674	1.000	molecular_function
GO:0005488	0.896	binding
GO:0003824	0.894	catalytic activity
GO:0140096	0.878	catalytic activity, acting on a protein
GO:0005515	0.696	protein binding
GO:0032452	0.696	histone demethylase activity
GO:0016491	0.434	oxidoreductase activity
GO:0051213	0.412	dioxygenase activity
GO:0016705	0.311	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0042221	0.970	response to chemical
GO:0050789	0.751	regulation of biological process
GO:0009987	0.740	cellular process
GO:0019222	0.714	regulation of metabolic process
GO:0050794	0.707	regulation of cellular process
GO:0060255	0.677	regulation of macromolecule metabolic process
GO:0010468	0.542	regulation of gene expression
GO:0031323	0.517	regulation of cellular metabolic process
GO:0051171	0.509	regulation of nitrogen compound metabolic process
GO:0080090	0.508	regulation of primary metabolic process
GO:0008152	0.431	metabolic process
GO:0048518	0.381	positive regulation of biological process
GO:0071704	0.355	organic substance metabolic process
GO:0009889	0.346	regulation of biosynthetic process
GO:0031326	0.332	regulation of cellular biosynthetic process
GO:0010556	0.330	regulation of macromolecule biosynthetic process
GO:0009893	0.314	positive regulation of metabolic process
GO:0019219	0.302	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.301	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.429	protein-containing complex
GO:0043232	0.377	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.434	Oxidoreductases.
EC:1.14.-.-	0.311	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.

[back to server]