StarFunc result for job id Q7LBR1

User Input

>input (199 residues)
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7LBR1	1.000	1.000	4.281E-26	199	1.000	1.000	Q7LBR1.pdb.gz	CHM1B_HUMAN Charged multivesicular body protein 1b OS=Homo sapiens OX=9606 GN=CHMP1B PE=1 SV=1
2	PDB:6tz402	0.529	0.595	5.620E-19	176	0.859	0.972	6tz402.pdb.gz
3	AFDB:Q95SH2	0.807	0.793	3.325E-18	203	0.749	0.734	Q95SH2.pdb.gz	Q95SH2_DROME Charged multivesicular body protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Chmp1 PE=1 SV=1
4	AFDB:O60074	0.632	0.629	1.290E-14	200	0.518	0.515	O60074.pdb.gz	DID2_SCHPO Vacuolar protein-sorting-associated protein 46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=did2 PE=3 SV=2
5	AFDB:Q9TXI3	0.633	0.616	2.318E-14	205	0.563	0.546	Q9TXI3.pdb.gz	Q9TXI3_CAEEL Charged multivesicular body protein 1b OS=Caenorhabditis elegans OX=6239 GN=did-2 PE=1 SV=1
6	AFDB:Q8LE58	0.672	0.659	4.966E-14	203	0.472	0.463	Q8LE58.pdb.gz	CHM1A_ARATH ESCRT-related protein CHMP1A OS=Arabidopsis thaliana OX=3702 GN=CHMP1A PE=1 SV=1
7	AFDB:Q6PHF0	0.641	0.643	1.196E-13	198	0.528	0.530	Q6PHF0.pdb.gz	CHM1A_DANRE Charged multivesicular body protein 1a OS=Danio rerio OX=7955 GN=chmp1a PE=2 SV=1
8	AFDB:Q921W0	0.519	0.527	4.605E-13	196	0.548	0.556	Q921W0.pdb.gz	CHM1A_MOUSE Charged multivesicular body protein 1a OS=Mus musculus OX=10090 GN=Chmp1a PE=1 SV=1
9	AFDB:Q38DX7	0.526	0.506	3.004E-12	207	0.447	0.430	Q38DX7.pdb.gz	Q38DX7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1770 PE=4 SV=1
10	AFDB:P69771	0.698	0.682	8.627E-12	204	0.422	0.412	P69771.pdb.gz	DID2_YEAST Vacuolar protein-sorting-associated protein 46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DID2 PE=1 SV=1
11	AFDB:Q5AQN4	0.535	0.510	2.648E-8	209	0.271	0.258	Q5AQN4.pdb.gz	Q5AQN4_EMENI SNF7 family protein Fti1/Did2, putative (AFU_orthologue AFUA_3G04060) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09396 PE=4 SV=1
12	PDB:3rx6A	0.368	0.388	3.476E-1	187	0.121	0.128	3rx6A.pdb.gz
13	PDB:7sqcO1	0.245	0.080	3.908E-1	673	0.196	0.058	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:3frtB	0.389	0.536	4.940E-1	142	0.070	0.099	3frtB.pdb.gz
15	PDB:7n6g3I	0.171	0.099	5.239E-1	401	0.206	0.102	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
16	PDB:6zh3A	0.304	0.345	7.446E-1	170	0.141	0.165	6zh3A.pdb.gz
17	PDB:2w6gG	0.231	0.315	8.877E-1	140	0.070	0.100	2w6gG.pdb.gz
18	PDB:5ok9B	0.169	0.139	1.122	242	0.070	0.058	5ok9B.pdb.gz
19	PDB:5bw9g	0.391	0.524	1.504	141	0.106	0.149	5bw9g.pdb.gz
20	PDB:7lbmn	0.203	0.152	1.504	283	0.060	0.042	7lbmn.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7LBR1	4.50e-145	403	199	1.000	1.000	CHM1B_HUMAN Charged multivesicular body protein 1b OS=Homo sapiens OX=9606 GN=CHMP1B PE=1 SV=1
2	Q95SH2	1.43e-88	260	203	0.749	0.734	Q95SH2_DROME Charged multivesicular body protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Chmp1 PE=1 SV=1
3	Q9TXI3	1.04e-76	230	205	0.553	0.537	Q9TXI3_CAEEL Charged multivesicular body protein 1b OS=Caenorhabditis elegans OX=6239 GN=did-2 PE=1 SV=1
4	Q921W0	5.07e-71	216	196	0.553	0.561	CHM1A_MOUSE Charged multivesicular body protein 1a OS=Mus musculus OX=10090 GN=Chmp1a PE=1 SV=1
5	Q9HD42	5.71e-71	215	196	0.553	0.561	CHM1A_HUMAN Charged multivesicular body protein 1a OS=Homo sapiens OX=9606 GN=CHMP1A PE=1 SV=1
6	O60074	1.53e-67	207	200	0.528	0.525	DID2_SCHPO Vacuolar protein-sorting-associated protein 46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=did2 PE=3 SV=2
7	Q6PHF0	4.29e-67	206	198	0.528	0.530	CHM1A_DANRE Charged multivesicular body protein 1a OS=Danio rerio OX=7955 GN=chmp1a PE=2 SV=1
8	Q8LE58	2.29e-62	194	203	0.467	0.458	CHM1A_ARATH ESCRT-related protein CHMP1A OS=Arabidopsis thaliana OX=3702 GN=CHMP1A PE=1 SV=1
9	Q38DX7	9.37e-55	175	207	0.442	0.425	Q38DX7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1770 PE=4 SV=1
10	Q9SSM4	1.36e-50	164	203	0.472	0.463	CHM1B_ARATH ESCRT-related protein CHMP1B OS=Arabidopsis thaliana OX=3702 GN=CHMP1B PE=1 SV=1
11	P69771	7.70e-46	152	204	0.422	0.412	DID2_YEAST Vacuolar protein-sorting-associated protein 46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DID2 PE=1 SV=1
12	Q5AQN4	1.51e-16	76.6	209	0.276	0.263	Q5AQN4_EMENI SNF7 family protein Fti1/Did2, putative (AFU_orthologue AFUA_3G04060) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09396 PE=4 SV=1
13	Q9DB34	2.28e-16	76.3	222	0.256	0.230	CHM2A_MOUSE Charged multivesicular body protein 2a OS=Mus musculus OX=10090 GN=Chmp2a PE=1 SV=1
14	Q9SKI2	4.95e-16	75.5	225	0.221	0.196	VPS2A_ARATH Vacuolar protein sorting-associated protein 2 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS2.1 PE=1 SV=2
15	O43633	6.10e-16	75.1	222	0.256	0.230	CHM2A_HUMAN Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1
16	Q9VBI3	4.01e-15	73.6	256	0.241	0.188	Q9VBI3_DROME RH72336p OS=Drosophila melanogaster OX=7227 GN=Vps2 PE=1 SV=1
17	Q8SXB1	4.67e-15	73.2	243	0.241	0.198	Q8SXB1_DROME GH16325p OS=Drosophila melanogaster OX=7227 GN=Vps2 PE=2 SV=1
18	Q9U2F6	5.45e-14	70.1	237	0.236	0.198	Q9U2F6_CAEEL Charged multivesicular body protein 2a OS=Caenorhabditis elegans OX=6239 GN=vps-2 PE=1 SV=1
19	O14177	9.29e-14	68.9	210	0.276	0.262	DID4_SCHPO ESCRT-III complex subunit did4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=did4 PE=3 SV=2
20	Q386U8	4.06e-13	67.4	214	0.276	0.257	Q386U8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0015 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06103 DUF948	8.9e+02	11.6	Bacterial protein of unknown function (DUF948)
2	PF14282 FlxA	14	17.2	FlxA-like protein
3	PF03398 Ist1	0.082	24.3	Regulator of Vps4 activity in the MVB pathway
4	PF05873 Mt_ATP-synt_D	3.8e+02	12.3	ATP synthase D chain, mitochondrial (ATP5H)
5	PF10123 Mu-like_Pro	2.4e+02	12.6	Mu-like prophage I protein
6	PF03357 Snf7	1.6e-13	62.1	Snf7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008586274.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008579238.1	0.995	IST1 homolog isoform X1
2	482537.XP_008564467.1	0.990	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 5 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008566119.1	0.990	Vacuolar protein sorting-associated protein 4A
4	482537.XP_008566416.1	0.990	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008576706.1	0.984	Charged multivesicular body protein 3
6	482537.XP_008589216.1	0.983	Charged multivesicular body protein 5
7	482537.XP_008577185.1	0.981	Charged multivesicular body protein 2a
8	482537.XP_008570544.1	0.976	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
9	482537.XP_008570589.1	0.975	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
10	482537.XP_008567073.1	0.961	Charged multivesicular body protein 6
11	482537.XP_008589484.1	0.959	Vacuolar protein sorting-associated protein 4B
12	482537.XP_008567362.1	0.949	Spastin isoform X1
13	482537.XP_008568244.1	0.949	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
14	482537.XP_008570114.1	0.949	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
15	482537.XP_008573495.1	0.942	Charged multivesicular body protein 7 isoform X1
16	482537.XP_008567114.1	0.941	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 7 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
17	482537.XP_008588866.1	0.930	Tumor susceptibility gene 101 protein isoform X1
18	482537.XP_008593196.1	0.928	Vacuolar protein sorting-associated protein 37B
19	482537.XP_008568766.1	0.923	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
20	482537.XP_008578109.1	0.922	STAM-binding protein isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.991	protein domain specific binding
GO:0042802	0.971	identical protein binding
GO:0090541	0.345	MIT domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051234	0.989	establishment of localization
GO:0051641	0.989	cellular localization
GO:0044237	0.988	cellular metabolic process
GO:0035891	0.984	exit from host cell
GO:0016236	0.983	macroautophagy
GO:0010256	0.981	endomembrane system organization
GO:0032506	0.981	cytokinetic process
GO:0071704	0.980	organic substance metabolic process
GO:0046907	0.980	intracellular transport
GO:0061640	0.979	cytoskeleton-dependent cytokinesis
GO:0044238	0.978	primary metabolic process
GO:0050794	0.978	regulation of cellular process
GO:0022607	0.977	cellular component assembly
GO:0046755	0.975	viral budding
GO:0019076	0.974	viral release from host cell
GO:0071985	0.972	multivesicular body sorting pathway
GO:0010564	0.972	regulation of cell cycle process
GO:0097352	0.968	autophagosome maturation
GO:0000281	0.966	mitotic cytokinesis
GO:1902115	0.964	regulation of organelle assembly
GO:0006998	0.963	nuclear envelope organization
GO:1902410	0.961	mitotic cytokinetic process
GO:0060236	0.960	regulation of mitotic spindle organization
GO:0006807	0.959	nitrogen compound metabolic process
GO:0046605	0.959	regulation of centrosome cycle
GO:0001778	0.958	plasma membrane repair
GO:0043162	0.948	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0071763	0.945	nuclear membrane organization
GO:0044091	0.939	membrane biogenesis
GO:0140014	0.925	mitotic nuclear division
GO:0007041	0.922	lysosomal transport
GO:0051303	0.918	establishment of chromosome localization
GO:0071709	0.916	membrane assembly
GO:0007080	0.908	mitotic metaphase plate congression
GO:0008104	0.906	protein localization
GO:0016197	0.888	endosomal transport
GO:0032509	0.846	endosome transport via multivesicular body sorting pathway
GO:0048519	0.664	negative regulation of biological process
GO:0048523	0.651	negative regulation of cellular process
GO:0060548	0.407	negative regulation of cell death
GO:0048518	0.375	positive regulation of biological process
GO:0070925	0.320	organelle assembly
GO:0045184	0.312	establishment of protein localization
GO:0016050	0.308	vesicle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0005770	0.996	late endosome
GO:0005634	0.995	nucleus
GO:0031981	0.991	nuclear lumen
GO:0098588	0.990	bounding membrane of organelle
GO:0012506	0.985	vesicle membrane
GO:0010008	0.983	endosome membrane
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0005829	0.974	cytosol
GO:0005576	0.970	extracellular region
GO:0032991	0.967	protein-containing complex
GO:0071944	0.959	cell periphery
GO:0015630	0.956	microtubule cytoskeleton
GO:0005886	0.954	plasma membrane
GO:0005874	0.951	microtubule
GO:0005771	0.951	multivesicular body
GO:0005819	0.950	spindle
GO:0005773	0.946	vacuole
GO:0031902	0.941	late endosome membrane
GO:0032585	0.929	multivesicular body membrane
GO:0005776	0.918	autophagosome
GO:0005774	0.915	vacuolar membrane
GO:0000421	0.913	autophagosome membrane
GO:0005828	0.907	kinetochore microtubule
GO:0030496	0.881	midbody
GO:1903561	0.875	extracellular vesicle
GO:0070062	0.866	extracellular exosome
GO:0036452	0.837	ESCRT complex
GO:0005764	0.836	lysosome
GO:0098796	0.832	membrane protein complex
GO:0005765	0.747	lysosomal membrane
GO:0005694	0.734	chromosome
GO:0031967	0.708	organelle envelope
GO:0140513	0.686	nuclear protein-containing complex
GO:0005635	0.660	nuclear envelope
GO:0005643	0.643	nuclear pore
GO:0000793	0.642	condensed chromosome
GO:0098687	0.613	chromosomal region
GO:0000779	0.578	condensed chromosome, centromeric region
GO:0000776	0.556	kinetochore
GO:0005654	0.512	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]