StarFunc result for job id Q7LC44

User Input

>input (396 residues)
MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERE
LKGLHRSVGKLESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVF
YRLERWADRLESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAA
GELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLS
QIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREAIQRELDLPQKQGEPLDQ
FLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQRGMEVQDDLE
QAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63053	0.663	0.663	1.737E-48	396	0.927	0.927	Q63053.pdb.gz	ARC_RAT Activity-regulated cytoskeleton-associated protein OS=Rattus norvegicus OX=10116 GN=Arc PE=1 SV=1
2	PDB:7r24A	0.336	0.810	2.611E-17	150	0.369	0.973	7r24A.pdb.gz
3	PDB:6taqA	0.193	0.435	1.917E-4	164	0.088	0.213	6taqA.pdb.gz
4	AFDB:F4IWM0	0.188	0.111	5.742E-4	818	0.126	0.061	F4IWM0.pdb.gz	F4IWM0_ARATH ATP binding / aminoacyl-tRNA ligase/ nucleotide binding protein OS=Arabidopsis thaliana OX=3702 GN=At3g42723 PE=4 SV=1
5	PDB:6tapD	0.182	0.412	1.543E-3	166	0.093	0.223	6tapD.pdb.gz
6	AFDB:P40061	0.237	0.069	1.143E-1	1430	0.111	0.031	P40061.pdb.gz	TSC11_YEAST Target of rapamycin complex 2 subunit TSC11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSC11 PE=1 SV=1
7	AFDB:Q4FKA6	0.121	0.082	1.576E-1	628	0.124	0.078	Q4FKA6.pdb.gz	Q4FKA6_TRYB2 Translation initiation factor eIF2B delta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.1400 PE=3 SV=1
8	AFDB:P31368	0.151	0.108	2.417E-1	601	0.159	0.105	P31368.pdb.gz	PDM1_DROME Protein nubbin OS=Drosophila melanogaster OX=7227 GN=nub PE=2 SV=1
9	AFDB:Q55GW5	0.122	0.059	5.999E-1	979	0.131	0.053	Q55GW5.pdb.gz	Q55GW5_DICDI Nuclear pore protein OS=Dictyostelium discoideum OX=44689 GN=nup93 PE=3 SV=1
10	AFDB:O94964	0.114	0.040	8.269E-1	1423	0.152	0.042	O94964.pdb.gz	SOGA1_HUMAN Protein SOGA1 OS=Homo sapiens OX=9606 GN=SOGA1 PE=1 SV=2
11	AFDB:P19524	0.084	0.028	1.268	1574	0.116	0.029	P19524.pdb.gz	MYO2_YEAST Myosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO2 PE=1 SV=1
12	PDB:2ggmA	0.160	0.350	1.301	149	0.040	0.107	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
13	PDB:7aqrV	0.078	0.195	1.448	140	0.063	0.179	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
14	AFDB:Q8BZI0	0.191	0.107	1.571	768	0.088	0.046	Q8BZI0.pdb.gz	AF1L1_MOUSE Actin filament-associated protein 1-like 1 OS=Mus musculus OX=10090 GN=Afap1l1 PE=1 SV=1
15	PDB:7pubFh	0.097	0.128	1.794	274	0.073	0.106	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
16	AFDB:Q5RII9	0.138	0.117	1.844	485	0.091	0.074	Q5RII9.pdb.gz	KTNA1_DANRE Katanin p60 ATPase-containing subunit A1 OS=Danio rerio OX=7955 GN=katna1 PE=2 SV=1
17	PDB:4n78F	0.125	0.279	2.221	156	0.058	0.147	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
18	PDB:8ap7D	0.120	0.208	3.062	193	0.076	0.155	8ap7D.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
19	PDB:1tjlA	0.162	0.394	3.595	145	0.023	0.062	1tjlA.pdb.gz	Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription
20	PDB:5yu7A	0.071	0.034	3.595	1118	0.078	0.028	5yu7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63053	0.0	751	396	0.927	0.927	ARC_RAT Activity-regulated cytoskeleton-associated protein OS=Rattus norvegicus OX=10116 GN=Arc PE=1 SV=1
2	Q7LC44	0.0	815	396	1.000	1.000	ARC_HUMAN Activity-regulated cytoskeleton-associated protein OS=Homo sapiens OX=9606 GN=ARC PE=1 SV=1
3	Q9WV31	0.0	754	396	0.929	0.929	ARC_MOUSE Activity-regulated cytoskeleton-associated protein OS=Mus musculus OX=10090 GN=Arc PE=1 SV=1
4	Q7JV70	0.013	38.9	193	0.093	0.192	ARC2_DROME Activity-regulated cytoskeleton associated protein 2 OS=Drosophila melanogaster OX=7227 GN=Arc2 PE=1 SV=1
5	Q7K1U0	0.061	37.4	254	0.101	0.157	ARC1_DROME Activity-regulated cytoskeleton associated protein 1 OS=Drosophila melanogaster OX=7227 GN=Arc1 PE=1 SV=1
6	Q3SWS9	0.43	35.4	626	0.066	0.042	JKIP1_RAT Janus kinase and microtubule-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Jakmip1 PE=1 SV=1
7	Q8BVL9	0.45	35.0	626	0.066	0.042	JKIP1_MOUSE Janus kinase and microtubule-interacting protein 1 OS=Mus musculus OX=10090 GN=Jakmip1 PE=1 SV=2
8	Q9UKU9	1.3	33.5	493	0.119	0.095	ANGL2_HUMAN Angiopoietin-related protein 2 OS=Homo sapiens OX=9606 GN=ANGPTL2 PE=1 SV=1
9	Q96N16	1.4	33.5	626	0.063	0.040	JKIP1_HUMAN Janus kinase and microtubule-interacting protein 1 OS=Homo sapiens OX=9606 GN=JAKMIP1 PE=1 SV=1
10	Q17383	2.0	33.1	1839	0.040	0.009	Q17383_CAEEL Hum-2 OS=Caenorhabditis elegans OX=6239 PE=2 SV=1
11	Q95ZU1	2.1	33.1	1809	0.040	0.009	Q95ZU1_CAEEL Myosin motor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hum-2 PE=1 SV=4
12	O82226	3.7	32.3	747	0.078	0.041	CNGC6_ARATH Probable cyclic nucleotide-gated ion channel 6 OS=Arabidopsis thaliana OX=3702 GN=CNGC6 PE=1 SV=2
13	Q9C0D2	4.0	32.3	2601	0.086	0.013	CE295_HUMAN Centrosomal protein of 295 kDa OS=Homo sapiens OX=9606 GN=CEP295 PE=1 SV=4
14	A0A1D8PT88	4.7	32.0	911	0.048	0.021	A0A1D8PT88_CANAL Kinesin-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KIP1 PE=3 SV=1
15	Q9M084	4.7	32.0	558	0.043	0.030	SYDC2_ARATH Aspartate--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=IBI1 PE=1 SV=1
16	Q9R045	4.9	32.0	493	0.086	0.069	ANGL2_MOUSE Angiopoietin-related protein 2 OS=Mus musculus OX=10090 GN=Angptl2 PE=2 SV=2
17	P15389	5.1	32.0	2019	0.045	0.009	SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn5a PE=1 SV=1
18	Q9JJV9	6.9	31.6	2019	0.071	0.014	SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus OX=10090 GN=Scn5a PE=1 SV=2
19	P35963	7.8	31.2	1435	0.131	0.036	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
20	Q14147	7.8	31.2	1143	0.056	0.019	DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens OX=9606 GN=DHX34 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18162 Arc_C	2e-43	157.5	Arc C-lobe
2	PF19284 Arc_MA	2.7e-56	199.6	Arc MA domain
3	PF12126 DUF3583	2.8e+02	12.3	Protein of unknown function (DUF3583)
4	PF15466 DUF4635	8e+02	10.9	Domain of unknown function (DUF4635)
5	PF05811 DUF842	2.6e+02	12.7	Eukaryotic protein of unknown function (DUF842)
6	PF03732 Retrotrans_gag	2.3	19.9	Retrotransposon gag protein
7	PF19259 Ty3_capsid	1.4e+02	13.3	Ty3 transposon capsid-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349022

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306245	0.966	Proto-oncogene c-Fos
2	9606.ENSP00000239938	0.964	Early growth response protein 1
3	9606.ENSP00000387699	0.955	Cyclic AMP-responsive element-binding protein 1
4	9606.ENSP00000320092	0.945	Endophilin-A3
5	9606.ENSP00000382428	0.935	Disks large homolog 4
6	9606.ENSP00000242480	0.932	E3 SUMO-protein ligase EGR2
7	9606.ENSP00000318057	0.928	Early growth response protein 3
8	9606.ENSP00000265354	0.927	Serum response factor
9	9606.ENSP00000245919	0.926	Protein fosB
10	9606.ENSP00000373905	0.919	Dynamin-2
11	9606.ENSP00000303315	0.908	Transcription factor jun-B
12	9606.ENSP00000271555	0.905	Myocyte-specific enhancer factor 2D
13	9606.ENSP00000252818	0.904	Transcription factor jun-D
14	9606.ENSP00000310170	0.903	Fos-related antigen 1
15	9606.ENSP00000269886	0.810	Endophilin-A2
16	9606.ENSP00000477455	0.775	Glutamate receptor ionotropic, NMDA 2B
17	9606.ENSP00000360608	0.755	Glutamate receptor ionotropic, NMDA 1
18	9606.ENSP00000284981	0.735	Amyloid-beta A4 protein
19	9606.ENSP00000428994	0.723	Glutamate receptor 1
20	9606.ENSP00000414303	0.710	Brain-derived neurotrophic factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.985	nucleic acid binding
GO:0003729	0.955	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0007275	0.975	multicellular organism development
GO:0048518	0.952	positive regulation of biological process
GO:0048522	0.930	positive regulation of cellular process
GO:0071840	0.874	cellular component organization or biogenesis
GO:0016043	0.852	cellular component organization
GO:1900271	0.838	regulation of long-term synaptic potentiation
GO:0007399	0.802	nervous system development
GO:0032879	0.800	regulation of localization
GO:0048869	0.783	cellular developmental process
GO:0051128	0.756	regulation of cellular component organization
GO:0050890	0.750	cognition
GO:0030100	0.746	regulation of endocytosis
GO:0007610	0.741	behavior
GO:0007611	0.728	learning or memory
GO:0022603	0.719	regulation of anatomical structure morphogenesis
GO:0007616	0.702	long-term memory
GO:0050806	0.696	positive regulation of synaptic transmission
GO:0030154	0.691	cell differentiation
GO:0060291	0.684	long-term synaptic potentiation
GO:0120036	0.681	plasma membrane bounded cell projection organization
GO:0099175	0.675	regulation of postsynapse organization
GO:0048259	0.671	regulation of receptor-mediated endocytosis
GO:0065009	0.663	regulation of molecular function
GO:0050896	0.656	response to stimulus
GO:0009653	0.626	anatomical structure morphogenesis
GO:0034330	0.587	cell junction organization
GO:0048583	0.577	regulation of response to stimulus
GO:0009966	0.561	regulation of signal transduction
GO:0031344	0.516	regulation of cell projection organization
GO:0019222	0.510	regulation of metabolic process
GO:0016358	0.463	dendrite development
GO:0044093	0.416	positive regulation of molecular function
GO:0120035	0.414	regulation of plasma membrane bounded cell projection organization
GO:0051179	0.388	localization
GO:0061001	0.371	regulation of dendritic spine morphogenesis
GO:0051716	0.335	cellular response to stimulus
GO:0060255	0.333	regulation of macromolecule metabolic process
GO:0007154	0.331	cell communication
GO:0031323	0.330	regulation of cellular metabolic process
GO:0023052	0.328	signaling
GO:0051171	0.310	regulation of nitrogen compound metabolic process
GO:0048519	0.309	negative regulation of biological process
GO:0080090	0.307	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0071944	0.995	cell periphery
GO:0005886	0.994	plasma membrane
GO:0043229	0.990	intracellular organelle
GO:0005829	0.990	cytosol
GO:0043227	0.987	membrane-bounded organelle
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0070013	0.950	intracellular organelle lumen
GO:0031982	0.919	vesicle
GO:0030054	0.891	cell junction
GO:0045202	0.856	synapse
GO:0005634	0.837	nucleus
GO:0012505	0.826	endomembrane system
GO:0098794	0.715	postsynapse
GO:0005856	0.680	cytoskeleton
GO:0036477	0.673	somatodendritic compartment
GO:0031410	0.581	cytoplasmic vesicle
GO:0031981	0.550	nuclear lumen
GO:0097060	0.442	synaptic membrane
GO:0098978	0.436	glutamatergic synapse
GO:0032991	0.389	protein-containing complex
GO:0031090	0.373	organelle membrane
GO:0098845	0.368	postsynaptic endosome
GO:0005654	0.365	nucleoplasm
GO:0045211	0.350	postsynaptic membrane
GO:0120025	0.341	plasma membrane bounded cell projection
GO:0098984	0.306	neuron to neuron synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]