StarFunc result for job id Q7LG56

User Input

>input (351 residues)
MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQ
ASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEA
RCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRK
STFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ
YLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFS
KVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4ADQ1	0.915	0.915	3.644E-41	351	0.940	0.940	D4ADQ1.pdb.gz	D4ADQ1_RAT Ribonucleotide reductase regulatory TP53 inducible subunit M2B OS=Rattus norvegicus OX=10116 GN=Rrm2b PE=3 SV=3
2	AFDB:P11157	0.907	0.817	4.966E-36	390	0.764	0.687	P11157.pdb.gz	RIR2_MOUSE Ribonucleoside-diphosphate reductase subunit M2 OS=Mus musculus OX=10090 GN=Rrm2 PE=1 SV=1
3	AFDB:Q32PP6	0.872	0.877	4.393E-35	349	0.735	0.739	Q32PP6.pdb.gz
4	AFDB:P48592	0.890	0.796	1.482E-34	393	0.721	0.644	P48592.pdb.gz	RIR2_DROME Ribonucleoside-diphosphate reductase subunit M2 OS=Drosophila melanogaster OX=7227 GN=RnrS PE=1 SV=2
5	AFDB:P42170	0.885	0.816	7.978E-32	381	0.647	0.596	P42170.pdb.gz	RIR2_CAEEL Ribonucleoside-diphosphate reductase small chain OS=Caenorhabditis elegans OX=6239 GN=rnr-2 PE=3 SV=1
6	PDB:3hf1B	0.790	0.966	2.896E-31	286	0.812	0.997	3hf1B.pdb.gz	2.6 A X-ray crystal structure of human p53R2, a p53-inducible ribonucleotide reductase .
7	AFDB:Q9LSD0	0.847	0.894	6.490E-31	332	0.613	0.648	Q9LSD0.pdb.gz	RIR2C_ARATH Ribonucleoside-diphosphate reductase small chain C OS=Arabidopsis thaliana OX=3702 GN=TSO2 PE=1 SV=1
8	AFDB:P36603	0.874	0.785	1.119E-30	391	0.632	0.568	P36603.pdb.gz	RIR2_SCHPO Ribonucleoside-diphosphate reductase small chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=suc22 PE=3 SV=2
9	AFDB:P50651	0.864	0.889	1.851E-30	341	0.601	0.619	P50651.pdb.gz	RIR2A_ARATH Ribonucleoside-diphosphate reductase small chain A OS=Arabidopsis thaliana OX=3702 GN=RNR2A PE=1 SV=2
10	PDB:1h0nA	0.806	0.982	5.011E-30	288	0.664	0.809	1h0nA.pdb.gz	Cobalt Substitution of Mouse R2 Ribonucleotide Reductase as a Model for Thereactive Diferrous State. Spectroscopic and Structural Evidence for a Ferromagnetically Coupled Dinuclear Cobalt Cluster
11	AFDB:Q382Q0	0.829	0.863	3.787E-29	337	0.584	0.608	Q382Q0.pdb.gz	Q382Q0_TRYB2 Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.v4.0007 PE=3 SV=1
12	AFDB:Q6FW29	0.856	0.755	1.080E-28	400	0.618	0.542	Q6FW29.pdb.gz	Q6FW29_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0D03432g PE=3 SV=1
13	PDB:1jk0A	0.799	0.838	9.550E-25	334	0.553	0.581	1jk0A.pdb.gz	Structure of the yeast ribonucleotide reductase Y2Y4 heterodimer.
14	PDB:1smsA	0.766	0.853	2.252E-18	314	0.376	0.420	1smsA.pdb.gz
15	PDB:6w4xC	0.722	0.678	2.750E-8	375	0.217	0.203	6w4xC.pdb.gz	Structure of a trapped radical transfer pathway within a ribonucleotide reductase holocomplex.
16	PDB:1uzrB	0.697	0.838	2.867E-8	288	0.162	0.198	1uzrB.pdb.gz	Crystal Structure of the Biologically Active Form of Class Ib Ribonucleotide Reductase Small Subunit from Mycobacterium Tuberculosis
17	PDB:3n37A	0.699	0.853	5.848E-8	284	0.151	0.187	3n37A.pdb.gz	Structural basis for activation of class Ib ribonucleotide reductase.
18	PDB:4ac8A	0.490	0.546	3.895E-4	311	0.131	0.148	4ac8A.pdb.gz	A Dynamic C-Terminal Segment in the Mycobacterium Tuberculosis Mn/Fe R2Lox Protein Can Adopt a Helical Structure with Possible Functional Consequences.
19	PDB:1fziA	0.427	0.310	1.695E-2	512	0.120	0.082	1fziA.pdb.gz	Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
20	PDB:2xz1A	0.435	0.432	3.457E-2	353	0.100	0.099	2xz1A.pdb.gz	Remote Control of Regioselectivity in Acyl-Acyl Carrier Protein-Desaturases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6ACU7	0.0	573	299	0.789	0.926	A0A8I6ACU7_RAT Ribonucleotide reductase regulatory TP53 inducible subunit M2B OS=Rattus norvegicus OX=10116 GN=Rrm2b PE=3 SV=1
2	D4ADQ1	0.0	684	351	0.940	0.940	D4ADQ1_RAT Ribonucleotide reductase regulatory TP53 inducible subunit M2B OS=Rattus norvegicus OX=10116 GN=Rrm2b PE=3 SV=3
3	P11157	0.0	575	390	0.764	0.687	RIR2_MOUSE Ribonucleoside-diphosphate reductase subunit M2 OS=Mus musculus OX=10090 GN=Rrm2 PE=1 SV=1
4	P31350	0.0	578	389	0.772	0.697	RIR2_HUMAN Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1
5	P48592	0.0	540	393	0.721	0.644	RIR2_DROME Ribonucleoside-diphosphate reductase subunit M2 OS=Drosophila melanogaster OX=7227 GN=RnrS PE=1 SV=2
6	Q4KLN6	0.0	572	390	0.749	0.674	RIR2_RAT Ribonucleoside-diphosphate reductase subunit M2 OS=Rattus norvegicus OX=10116 GN=Rrm2 PE=2 SV=1
7	Q6PEE3	0.0	683	351	0.934	0.934	RIR2B_MOUSE Ribonucleoside-diphosphate reductase subunit M2 B OS=Mus musculus OX=10090 GN=Rrm2b PE=1 SV=1
8	Q7LG56	0.0	723	351	1.000	1.000	RIR2B_HUMAN Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens OX=9606 GN=RRM2B PE=1 SV=1
9	Q7ZYW0	0.0	546	349	0.735	0.739	Q7ZYW0_DANRE Ribonucleoside-diphosphate reductase subunit M2 B OS=Danio rerio OX=7955 GN=fb72h01 PE=3 SV=1
10	P42170	1.15e-169	479	381	0.655	0.604	RIR2_CAEEL Ribonucleoside-diphosphate reductase small chain OS=Caenorhabditis elegans OX=6239 GN=rnr-2 PE=3 SV=1
11	P09938	3.02e-163	463	399	0.618	0.544	RIR2_YEAST Ribonucleoside-diphosphate reductase small chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RNR2 PE=1 SV=2
12	P36603	2.70e-162	461	391	0.638	0.573	RIR2_SCHPO Ribonucleoside-diphosphate reductase small chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=suc22 PE=3 SV=2
13	Q6FW29	5.66e-162	460	400	0.618	0.542	Q6FW29_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0D03432g PE=3 SV=1
14	Q382Q2	7.79e-156	442	337	0.601	0.626	Q382Q2_TRYB2 Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.v4.0005 PE=3 SV=1
15	Q382Q1	2.32e-155	441	337	0.601	0.626	Q382Q1_TRYB2 Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.v4.0006 PE=3 SV=1
16	Q382Q3	2.21e-154	439	337	0.601	0.626	Q382Q3_TRYB2 Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.v4.0004 PE=3 SV=1
17	Q9LSD0	3.42e-154	438	332	0.621	0.657	RIR2C_ARATH Ribonucleoside-diphosphate reductase small chain C OS=Arabidopsis thaliana OX=3702 GN=TSO2 PE=1 SV=1
18	Q382Q0	1.51e-151	431	337	0.587	0.611	Q382Q0_TRYB2 Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.v4.0007 PE=3 SV=1
19	P50651	3.87e-151	431	341	0.610	0.628	RIR2A_ARATH Ribonucleoside-diphosphate reductase small chain A OS=Arabidopsis thaliana OX=3702 GN=RNR2A PE=1 SV=2
20	P42521	3.91e-147	420	338	0.570	0.592	RIR2_DICDI Ribonucleoside-diphosphate reductase small subunit OS=Dictyostelium discoideum OX=44689 GN=rnrB-1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00268 Ribonuc_red_sm	4.4e-114	392.3	Ribonucleotide reductase, small chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251810

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300738	0.999	Ribonucleoside-diphosphate reductase large subunit
2	9606.ENSP00000269305	0.996	Cellular tumor antigen p53
3	9606.ENSP00000353770	0.974	Ribonucleoside-diphosphate reductase subunit M2
4	9606.ENSP00000304802	0.942	Thymidylate kinase
5	9606.ENSP00000363641	0.938	Thioredoxin
6	9606.ENSP00000360939	0.936	UMP-CMP kinase
7	9606.ENSP00000219479	0.932	Nucleoside diphosphate kinase, mitochondrial
8	9606.ENSP00000256722	0.926	UMP-CMP kinase 2, mitochondrial
9	9606.ENSP00000346921	0.926	Adenylate kinase 2, mitochondrial
10	9606.ENSP00000416658	0.924	Nucleoside diphosphate kinase 6
11	9606.ENSP00000356785	0.921	Nucleoside diphosphate kinase 7
12	9606.ENSP00000369314	0.918	Glutaredoxin-1
13	9606.ENSP00000371230	0.918	GTP:AMP phosphotransferase AK3, mitochondrial
14	9606.ENSP00000264093	0.916	Deoxyguanosine kinase, mitochondrial
15	9606.ENSP00000355689	0.916	Guanylate kinase
16	9606.ENSP00000360561	0.916	Ectonucleoside triphosphate diphosphohydrolase 8
17	9606.ENSP00000301825	0.915	Ectonucleoside triphosphate diphosphohydrolase 3
18	9606.ENSP00000219302	0.914	Nucleoside diphosphate kinase 3
19	9606.ENSP00000320171	0.912	Pyruvate kinase PKM
20	9606.ENSP00000337060	0.911	Nucleoside diphosphate kinase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004748	1.000	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
GO:0042802	0.993	identical protein binding
GO:0043167	0.756	ion binding
GO:0043169	0.745	cation binding
GO:0046872	0.744	metal ion binding
GO:0046914	0.696	transition metal ion binding
GO:0046983	0.351	protein dimerization activity
GO:0005506	0.340	iron ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0044281	0.971	small molecule metabolic process
GO:0050896	0.950	response to stimulus
GO:0034641	0.908	cellular nitrogen compound metabolic process
GO:1901360	0.907	organic cyclic compound metabolic process
GO:0046483	0.907	heterocycle metabolic process
GO:0006725	0.906	cellular aromatic compound metabolic process
GO:0006139	0.904	nucleobase-containing compound metabolic process
GO:0065007	0.859	biological regulation
GO:0055086	0.852	nucleobase-containing small molecule metabolic process
GO:0006796	0.811	phosphate-containing compound metabolic process
GO:0050789	0.784	regulation of biological process
GO:0043170	0.709	macromolecule metabolic process
GO:0050794	0.656	regulation of cellular process
GO:0034654	0.633	nucleobase-containing compound biosynthetic process
GO:0019637	0.616	organophosphate metabolic process
GO:0009117	0.528	nucleotide metabolic process
GO:0071840	0.515	cellular component organization or biogenesis
GO:0042221	0.504	response to chemical
GO:0016043	0.470	cellular component organization
GO:0048518	0.462	positive regulation of biological process
GO:0044260	0.453	cellular macromolecule metabolic process
GO:0090304	0.448	nucleic acid metabolic process
GO:0006259	0.443	DNA metabolic process
GO:0010243	0.440	response to organonitrogen compound
GO:0051716	0.413	cellular response to stimulus
GO:0006950	0.397	response to stress
GO:1901135	0.391	carbohydrate derivative metabolic process
GO:0048522	0.391	positive regulation of cellular process
GO:1901293	0.382	nucleoside phosphate biosynthetic process
GO:0006974	0.331	cellular response to DNA damage stimulus
GO:0009262	0.331	deoxyribonucleotide metabolic process
GO:0006996	0.323	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.995	nuclear lumen
GO:0005829	0.983	cytosol
GO:0005654	0.977	nucleoplasm
GO:0005739	0.970	mitochondrion
GO:0032991	0.759	protein-containing complex
GO:0043232	0.316	intracellular non-membrane-bounded organelle
GO:1902494	0.306	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23252	1.000	[thioredoxin]-disulfide + a 2'-deoxyribonucleoside 5'-diphosphate + H2O = [thioredoxin]-dithiol + a ribonucleoside 5'-diphosphate
EC:1.17.4.1	1.000	ribonucleoside-diphosphate reductase.

[back to server]