StarFunc result for job id Q7RTP6

User Input

>input (2002 residues)
MEERKHETMNPAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLIQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNINVNFLR
PSQVRHLYDTGETKDIHLEMESLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLPSSDTLDLNAEEKAVLIASTRSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEAPRGHRGERPTLVSTLTDRRMDVAVGNQN
KVKYMATQLLAKFEENAPAQSIGIRRQGSMKKEFPQNLGGSDTCYFCQKRVYVMERLSAE
GKFFHRSCFKCEYCATTLRLSAYAYDIEDGKFYCKPHYCYRLSGYAQRKRPAVAPLSGKE
AKGPLQDGATTDANGRANAVASSTERTPGSGVNGLEEPSIAKRLRGTPERIELENYRLSL
RQAEALQEVPEETQAEHNLSSVLDTGAEEDVASSSSESEMEEEGEEEEEEPRLPPSDLGG
VPWKEAVRIHALLKGKSEEELEASKSFGPGNEEEEEEEEEYEEEEEEDYDEEEEESSEAG
NQRLQQVMHAADPLEIQADVHWTHIREREEEERMAPASESSASGAPLDENDLEEDVDSEP
AEIEGEAAEDGDPGDTGAELDDDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKL
PASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGPQLPPVPAATQEKSPEERLFPE
PLLPKEKPKADAPSDLKAVHSPIRSQPVTLPEARTPVSPGSPQPQPPVAASTPPPSPLPI
CSQPQPSTEATVPSPTQSPIRFQPAPAKTSTPLAPLPVQSQSDTKDRLGSPLAVDEALRR
SDLVEEFWMKSAEIRRSLGLTPVDRSKGPEPSFPTPAFRPVSLKSYSVEKSPQDEGLHLL
KPLSIPKRLGLPKPEGEPLSLPTPRSPSDRELRSAQEERRELSSSSGLGLHGSSSNMKTL
GSQSFNTSDSAMLTPPSSPPPPPPPGEEPATLRRKLREAEPNASVVPPPLPATWMRPPRE
PAQPPREEVRKSFVESVEEIPFADDVEDTYDDKTEDSSLQEKFFTPPSCWPRPEKPRHPP
LAKENGRLPALEGTLQPQKRGLPLVSAEAKELAEERMRAREKSVKSQALRDAMARQLSRM
QQMELASGAPRPRKASSAPSQGKERRPDSPTRPTLRGSEEPTLKHEATSEEVLSPPSDSG
GPDGSFTSSEGSSGKSKKRSSLFSPRRNKKEKKSKGEGRPPEKPSSNLLEEAAAKPKSLW
KSVFSGYKKDKKKKADDKSCPSTPSSGATVDSGKHRVLPVVRAELQLRRQLSFSEDSDLS
SDDVLEKSSQKSRREPRTYTEEELNAKLTRRVQKAARRQAKQEELKRLHRAQIIQRQLQQ
VEERQRRLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQEKNAMVRYESELMIFARE
LELEDRQSRLQQELRERMAVEDHLKTEEELSEEKQILNEMLEVVEQRDSLVALLEEQRLR
EREEDKDLEAAMLSKGFSLNWS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1RA39	0.254	0.356	0.000	1413	0.373	0.528	F1RA39.pdb.gz	MCA2B_DANRE [F-actin]-monooxygenase mical2b OS=Danio rerio OX=7955 GN=mical2b PE=2 SV=3
2	AFDB:Q7RTP6	1.000	1.000	0.000	2002	1.000	1.000	Q7RTP6.pdb.gz	MICA3_HUMAN [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2
3	AFDB:Q8BML1	0.247	0.509	4.715E-99	960	0.278	0.580	Q8BML1.pdb.gz	MICA2_MOUSE [F-actin]-monooxygenase MICAL2 OS=Mus musculus OX=10090 GN=Mical2 PE=1 SV=2
4	AFDB:O94851	0.243	0.432	2.165E-91	1124	0.287	0.511	O94851.pdb.gz	MICA2_HUMAN [F-actin]-monooxygenase MICAL2 OS=Homo sapiens OX=9606 GN=MICAL2 PE=1 SV=2
5	PDB:3ihgA	0.131	0.445	1.794E-9	535	0.033	0.123	3ihgA.pdb.gz	Structural basis for substrate recognition and specificity in aklavinone-11-hydroxylase from rhodomycin biosynthesis.
6	PDB:5fn0A	0.113	0.414	3.641E-9	455	0.038	0.169	5fn0A.pdb.gz	Kynurenine-3-Monooxygenase Inhibition Prevents Multiple Organ Failure in Rodent Models of Acute Pancreatitis.
7	PDB:7on9A	0.121	0.524	5.835E-9	393	0.030	0.155	7on9A.pdb.gz	Debottlenecking 4-hydroxybenzoate hydroxylation in Pseudomonas putida KT2440 improves muconate productivity from p-coumarate.
8	PDB:2dkiA	0.121	0.350	7.047E-9	615	0.025	0.081	2dkiA.pdb.gz	Crystal structure of 3-hydroxybenzoate hydroxylase from Comamonas testosteroni has a large tunnel for substrate and oxygen access to the active site
9	PDB:6lkeA	0.113	0.447	1.028E-8	428	0.025	0.119	6lkeA.pdb.gz	Full-length in meso structure and mechanism of rat kynurenine 3-monooxygenase inhibition.
10	PDB:1d7lA	0.116	0.486	4.036E-8	394	0.032	0.165	1d7lA.pdb.gz	Structure-function correlations of the reaction of reduced nicotinamide analogues with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins.
11	PDB:5wgrA	0.125	0.333	5.357E-8	664	0.034	0.102	5wgrA.pdb.gz	Function and Structure of MalA/MalA', Iterative Halogenases for Late-Stage C-H Functionalization of Indole Alkaloids.
12	PDB:5dbjE	0.129	0.529	6.469E-8	437	0.028	0.130	5dbjE.pdb.gz	Crystal structure of halogenase PltA from the pyoluteorin biosynthetic pathway.
13	PDB:4k22A	0.124	0.590	4.691E-7	354	0.027	0.153	4k22A.pdb.gz
14	PDB:3rp6A	0.120	0.510	4.918E-7	392	0.029	0.148	3rp6A.pdb.gz	Structural and Mechanistic Studies of HpxO, a Novel Flavin Adenine Dinucleotide-Dependent Urate Oxidase from Klebsiella pneumoniae.
15	AFDB:A1ZAU8	0.055	0.066	2.802E-3	1630	0.109	0.134	A1ZAU8.pdb.gz	PTRO_DROME Patronin OS=Drosophila melanogaster OX=7227 GN=Patronin PE=1 SV=1
16	AFDB:Q8IJP9	0.031	0.026	1.050E-2	2578	0.067	0.052	Q8IJP9.pdb.gz	Q8IJP9_PLAF7 Transcriptional coactivator ADA2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1014600 PE=4 SV=1
17	AFDB:B1AR10	0.034	0.052	1.531E-2	1109	0.085	0.154	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
18	AFDB:Q8VIG1	0.033	0.047	2.032E-2	1082	0.085	0.158	Q8VIG1.pdb.gz	REST_MOUSE RE1-silencing transcription factor OS=Mus musculus OX=10090 GN=Rest PE=1 SV=2
19	AFDB:Q8IVL1	0.054	0.044	3.106E-2	2488	0.095	0.077	Q8IVL1.pdb.gz	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
20	AFDB:Q8BZ21	0.032	0.032	6.013E-2	2003	0.100	0.100	Q8BZ21.pdb.gz	KAT6A_MOUSE Histone acetyltransferase KAT6A OS=Mus musculus OX=10090 GN=Kat6a PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RA39	0.0	1018	1679	0.246	0.293	MCA2B_DANRE [F-actin]-monooxygenase mical2b OS=Danio rerio OX=7955 GN=mical2b PE=2 SV=3
2	O94851	0.0	1055	1957	0.255	0.261	MICA2_HUMAN [F-actin]-monooxygenase MICAL2 OS=Homo sapiens OX=9606 GN=MICAL2 PE=1 SV=2
3	Q7RTP6	0.0	4083	2002	1.000	1.000	MICA3_HUMAN [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2
4	Q86BA1	0.0	709	4723	0.179	0.076	MICAL_DROME [F-actin]-monooxygenase Mical OS=Drosophila melanogaster OX=7227 GN=Mical PE=1 SV=1
5	Q8BML1	0.0	1035	1951	0.250	0.256	MICA2_MOUSE [F-actin]-monooxygenase MICAL2 OS=Mus musculus OX=10090 GN=Mical2 PE=1 SV=2
6	Q8TDZ2	0.0	694	1067	0.176	0.330	MICA1_HUMAN [F-actin]-monooxygenase MICAL1 OS=Homo sapiens OX=9606 GN=MICAL1 PE=1 SV=2
7	Q8VDP3	0.0	673	1048	0.174	0.332	MICA1_MOUSE [F-actin]-monooxygenase MICAL1 OS=Mus musculus OX=10090 GN=Mical1 PE=1 SV=1
8	Q8IY33	3.47e-40	165	904	0.045	0.101	MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2 PE=1 SV=1
9	D3ZEN0	5.31e-40	164	1014	0.048	0.096	MILK2_RAT MICAL-like protein 2 OS=Rattus norvegicus OX=10116 GN=Micall2 PE=1 SV=2
10	Q3TN34	8.88e-39	160	1009	0.044	0.087	MILK2_MOUSE MICAL-like protein 2 OS=Mus musculus OX=10090 GN=Micall2 PE=1 SV=1
11	E1BBG2	1.45e-31	137	853	0.029	0.068	MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus OX=9913 GN=MICALL1 PE=1 SV=2
12	Q8N3F8	1.69e-30	134	863	0.027	0.063	MILK1_HUMAN MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2
13	Q8BGT6	1.85e-30	133	870	0.027	0.062	MILK1_MOUSE MICAL-like protein 1 OS=Mus musculus OX=10090 GN=Micall1 PE=1 SV=3
14	D3ZQL6	2.09e-30	133	855	0.027	0.063	MILK1_RAT MICAL-like protein 1 OS=Rattus norvegicus OX=10116 GN=Micall1 PE=1 SV=1
15	F1QAZ3	2.43e-28	126	783	0.025	0.064	F1QAZ3_DANRE Mical-like 2b OS=Danio rerio OX=7955 GN=MICAL-2 PE=1 SV=2
16	P05095	1.06e-23	111	861	0.026	0.060	ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum OX=44689 GN=abpA PE=1 SV=2
17	P15508	1.75e-23	112	2128	0.026	0.024	SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus OX=10090 GN=Sptb PE=1 SV=4
18	Q6XDA0	2.13e-23	111	2137	0.026	0.024	Q6XDA0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1
19	A0A8I6AWM3	2.18e-23	111	2329	0.026	0.022	A0A8I6AWM3_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1
20	A0A8I6G9M6	2.20e-23	111	2325	0.026	0.022	A0A8I6G9M6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01262 AlaDh_PNT_C	2.5e+02	12.4	Alanine dehydrogenase/PNT, C-terminal domain
2	PF12130 bMERB_dom	1e-41	153.6	Bivalent Mical/EHBP Rab binding domain
3	PF11971 CAMSAP_CH	7.9e-10	49.7	CAMSAP CH domain
4	PF00307 CH	8.8e-17	72.6	Calponin homology (CH) domain
5	PF01266 DAO	2	19.6	FAD dependent oxidoreductase
6	PF00890 FAD_binding_2	8.8	16.9	FAD binding domain
7	PF01494 FAD_binding_3	0.073	23.9	FAD binding domain
8	PF03486 HI0933_like	15	15.8	HI0933-like protein
9	PF00412 LIM	8e-05	34.1	LIM domain
10	PF13241 NAD_binding_7	7.3	18.4	Putative NAD(P)-binding
11	PF13450 NAD_binding_8	11	17.6	NAD(P)-binding Rossmann-like domain
12	PF00070 Pyr_redox	24	16.8	Pyridine nucleotide-disulphide oxidoreductase
13	PF07992 Pyr_redox_2	0.6	20.9	Pyridine nucleotide-disulphide oxidoreductase
14	PF13738 Pyr_redox_3	0.18	22.6	Pyridine nucleotide-disulphide oxidoreductase
15	PF01946 Thi4	3e+02	12.0	Thi4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416015

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300935	0.985	Ras-related protein Rab-8A
2	9606.ENSP00000260363	0.957	Kinesin-like protein KIF23
3	9606.ENSP00000387286	0.827	Ras-related protein Rab-1A
4	9606.ENSP00000310226	0.741	Ras-related protein Rab-1B
5	9606.ENSP00000468263	0.741	ELKS/Rab6-interacting/CAST family member 1
6	9606.ENSP00000256194	0.725	[F-actin]-monooxygenase MICAL2
7	9606.ENSP00000215957	0.704	MICAL-like protein 1
8	9606.ENSP00000352882	0.664	Plexin-A4
9	9606.ENSP00000278886	0.663	Ninein-like protein
10	9606.ENSP00000297508	0.663	MICAL-like protein 2
11	9606.ENSP00000352264	0.655	CD2-associated protein
12	9606.ENSP00000360305	0.648	PDZ and LIM domain protein 1
13	9606.ENSP00000303908	0.643	Twinfilin-2
14	9606.ENSP00000256186	0.639	MICAL C-terminal-like protein
15	9606.ENSP00000263116	0.631	Ras-related protein Rab-36
16	9606.ENSP00000343690	0.627	Dihydropyrimidinase-related protein 3
17	9606.ENSP00000480359	0.617	PDZ and LIM domain protein 5
18	9606.ENSP00000368759	0.612	Enhancer of filamentation 1
19	9606.ENSP00000253754	0.609	PDZ and LIM domain protein 4
20	9606.ENSP00000284770	0.608	PDZ and LIM domain protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060090	0.999	molecular adaptor activity
GO:0003779	0.999	actin binding
GO:0003824	0.720	catalytic activity
GO:0043167	0.592	ion binding
GO:0043168	0.474	anion binding
GO:0097159	0.473	organic cyclic compound binding
GO:1901363	0.465	heterocyclic compound binding
GO:0000166	0.402	nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0016043	0.980	cellular component organization
GO:0030036	0.974	actin cytoskeleton organization
GO:0051261	0.969	protein depolymerization
GO:0007015	0.950	actin filament organization
GO:0030042	0.929	actin filament depolymerization
GO:0051179	0.900	localization
GO:0050789	0.617	regulation of biological process
GO:0050794	0.465	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0031981	0.996	nuclear lumen
GO:0005654	0.990	nucleoplasm
GO:0030496	0.884	midbody
GO:0045171	0.697	intercellular bridge
GO:0090543	0.682	Flemming body
GO:0043232	0.539	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]