StarFunc result for job id Q7RTR0

User Input

>input (991 residues)
MAESFFSDFGLLWYLKELRKEEFWKFKELLKQPLEKFELKPIPWAELKKASKEDVAKLLD
KHYPGKQAWEVTLNLFLQINRKDLWTKAQEEMRNKLNPYRKHMKETFQLIWEKETCLHVP
EHFYKETMKNEYKELNDAYTAAARRHTVVLEGPDGIGKTTLLRKVMLDWAEGNLWKDRFT
FVFFLNVCEMNGIAETSLLELLSRDWPESSEKIEDIFSQPERILFIMDGFEQLKFNLQLK
ADLSDDWRQRQPMPIILSSLLQKKMLPESSLLIALGKLAMQKHYFMLRHPKLIKLLGFSE
SEKKSYFSYFFGEKSKALKVFNFVRDNGPLFILCHNPFTCWLVCTCVKQRLERGEDLEIN
SQNTTYLYASFLTTVFKAGSQSFPPKVNRARLKSLCALAAEGIWTYTFVFSHGDLRRNGL
SESEGVMWVGMRLLQRRGDCFAFMHLCIQEFCAAMFYLLKRPKDDPNPAIGSITQLVRAS
VVQPQTLLTQVGIFMFGISTEEIVSMLETSFGFPLSKDLKQEITQCLESLSQCEADREAI
AFQELFIGLFETQEKEFVTKVMNFFEEVFIYIGNIEHLVIASFCLKHCQHLTTLRMCVEN
IFPDDSGCISDYNEKLVYWRELCSMFITNKNFQILDMENTSLDDPSLAILCKALAQPVCK
LRKLIFTSVYFGHDSELFKAVLHNPHLKLLSLYGTSLSQSDIRHLCETLKHPMCKIEELI
LGKCDISSEVCEDIASVLACNSKLKHLSLVENPLRDEGMTLLCEALKHSHCALERLMLMY
CCLTSVSCDSISEVLLCSKSLSLLDLGSNALEDNGVASLCAALKHPGCSIRELWLMGCFL
TSDSCKDIAAVLICNGKLKTLKLGHNEIGDTGVRQLCAALQHPHCKLECLGLQTCPITRA
CCDDIAAALIACKTLRSLNLDWIALDADAVVVLCEALSHPDCALQMLGLHKSGFDEETQK
ILMSVEEKIPHLTISHGPWIDEEYKIRGVLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7RTR0	1.000	1.000	0.000	991	1.000	1.000	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
2	AFDB:Q66X22	0.839	0.830	8.775E-87	1003	0.458	0.453	Q66X22.pdb.gz	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
3	AFDB:Q66X01	0.845	0.835	7.558E-86	1004	0.447	0.441	Q66X01.pdb.gz	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1
4	AFDB:Q66X03	0.712	0.740	1.610E-83	949	0.435	0.454	Q66X03.pdb.gz	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1
5	AFDB:Q96MN2	0.799	0.797	8.783E-82	994	0.414	0.412	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
6	AFDB:Q86W24	0.693	0.636	2.062E-77	1093	0.400	0.362	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
7	AFDB:Q3UWL9	0.697	0.727	2.295E-68	944	0.346	0.363	Q3UWL9.pdb.gz	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
8	AFDB:P59045	0.676	0.653	2.462E-67	1033	0.339	0.325	P59045.pdb.gz	NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
9	AFDB:P59047	0.640	0.545	1.559E-66	1200	0.330	0.273	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
10	AFDB:F1MT67	0.690	0.631	2.529E-66	1098	0.334	0.301	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
11	PDB:7pzcA	0.521	0.514	1.127E-51	1010	0.331	0.325	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.460	0.532	1.346E-41	806	0.290	0.356	7lfhA.pdb.gz
13	PDB:6npyA	0.417	0.478	2.386E-36	798	0.292	0.362	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:1a4yA	0.387	0.807	5.369E-22	460	0.127	0.274	1a4yA.pdb.gz
15	PDB:4kxfP	0.423	0.471	6.401E-22	866	0.155	0.178	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
16	PDB:3jblA	0.344	0.367	3.495E-15	909	0.158	0.173	3jblA.pdb.gz
17	PDB:6b5bA	0.310	0.266	1.426E-14	1199	0.150	0.124	6b5bA.pdb.gz
18	PDB:5yudA	0.299	0.255	1.354E-11	1238	0.155	0.124	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
19	PDB:6o60C	0.268	0.599	5.672E-10	389	0.079	0.201	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
20	PDB:3oglB	0.222	0.346	1.532E-8	568	0.079	0.137	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UWL9	0.0	606	944	0.348	0.365	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
2	Q66X01	0.0	832	1004	0.449	0.443	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1
3	Q66X03	0.0	818	949	0.444	0.464	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1
4	Q66X22	0.0	854	1003	0.459	0.454	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
5	Q7RTR0	0.0	2040	991	1.000	1.000	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
6	Q86W24	0.0	663	1093	0.378	0.343	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
7	Q96MN2	0.0	781	994	0.417	0.415	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
8	P59046	2.46e-180	554	1061	0.349	0.326	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
9	P59045	5.71e-176	541	1033	0.343	0.329	NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
10	Q66X05	5.25e-173	531	959	0.311	0.321	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1
11	Q96P20	4.16e-159	498	1036	0.306	0.292	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
12	J3KN39	6.60e-159	498	1059	0.343	0.321	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
13	F1MT67	6.80e-159	499	1098	0.339	0.306	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
14	E9Q5R7	1.22e-158	497	1054	0.329	0.309	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
15	Q9NX02	1.44e-158	497	1062	0.342	0.319	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
16	Q647I9	1.47e-157	495	1098	0.337	0.304	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
17	Q8R4B8	2.13e-157	493	1033	0.336	0.322	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
18	D4A523	1.73e-152	480	1035	0.338	0.324	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
19	Q66JP4	2.04e-148	460	738	0.263	0.354	Q66JP4_MOUSE NLR family, pyrin domain containing 4G OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
20	P59047	1.11e-135	440	1200	0.283	0.233	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	4.4	19.2	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	1	21.2	AAA ATPase domain
3	PF13401 AAA_22	65	15.2	AAA domain
4	PF13481 AAA_25	16	16.5	AAA domain
5	PF13604 AAA_30	7.9e+02	11.1	AAA domain
6	PF13516 LRR_6	0.0013	29.6	Leucine Rich repeat
7	PF01078 Mg_chelatase	4.5e+02	11.6	Magnesium chelatase, subunit ChlI
8	PF05729 NACHT	1.1e-31	121.4	NACHT domain
9	PF00931 NB-ARC	2.1e+02	12.5	NB-ARC domain
10	PF17776 NLRC4_HD2	1.2e-15	69.7	NLRC4 helical domain HD2
11	PF17779 NOD2_WH	1.4e-07	43.0	NOD2 winged helix domain
12	PF02758 PYRIN	1.2e-22	91.2	PAAD/DAPIN/Pyrin domain
13	PF03193 RsgA_GTPase	1.9e+02	13.3	RsgA GTPase
14	PF05272 VirE	4e+02	11.8	Virulence-associated protein E

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331857

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433138	0.947	Caspase-1
2	9606.ENSP00000357112	0.943	Interferon-inducible protein AIM2
3	9606.ENSP00000247470	0.929	Apoptosis-associated speck-like protein containing a CARD
4	9606.ENSP00000376849	0.927	Caspase-5
5	9606.ENSP00000375767	0.917	Caspase recruitment domain-containing protein 8
6	9606.ENSP00000478516	0.917	NACHT, LRR and PYD domains-containing protein 1
7	9606.ENSP00000337383	0.908	NACHT, LRR and PYD domains-containing protein 3
8	9606.ENSP00000225296	0.905	Putative ATP-dependent RNA helicase DHX33
9	9606.ENSP00000433209	0.868	Gasdermin-D
10	9606.ENSP00000385090	0.786	NLR family CARD domain-containing protein 4
11	9606.ENSP00000382840	0.720	ATP-dependent RNA helicase DDX3X
12	9606.ENSP00000445675	0.659	Melanoma antigen preferentially expressed in tumors
13	9606.ENSP00000428657	0.650	Baculoviral IAP repeat-containing protein 1
14	9606.ENSP00000219596	0.640	Pyrin
15	9606.ENSP00000309767	0.630	NACHT, LRR and PYD domains-containing protein 6
16	9606.ENSP00000436552	0.566	Protein turtle homolog B
17	9606.ENSP00000388566	0.547	Caspase-4
18	9606.ENSP00000367942	0.532	Growth/differentiation factor 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:1901363	0.466	heterocyclic compound binding
GO:0097159	0.466	organic cyclic compound binding
GO:0003824	0.414	catalytic activity
GO:0097367	0.413	carbohydrate derivative binding
GO:0003676	0.395	nucleic acid binding
GO:0016787	0.389	hydrolase activity
GO:0140657	0.358	ATP-dependent activity
GO:0016887	0.322	ATP hydrolysis activity
GO:0003723	0.310	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0009987	0.985	cellular process
GO:0048518	0.982	positive regulation of biological process
GO:0051239	0.980	regulation of multicellular organismal process
GO:0080090	0.979	regulation of primary metabolic process
GO:0065009	0.978	regulation of molecular function
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0032652	0.974	regulation of interleukin-1 production
GO:0045862	0.969	positive regulation of proteolysis
GO:0043085	0.930	positive regulation of catalytic activity
GO:0050794	0.927	regulation of cellular process
GO:0043281	0.901	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0050896	0.894	response to stimulus
GO:2001056	0.891	positive regulation of cysteine-type endopeptidase activity
GO:0032732	0.874	positive regulation of interleukin-1 production
GO:0032651	0.872	regulation of interleukin-1 beta production
GO:0032731	0.829	positive regulation of interleukin-1 beta production
GO:0031323	0.821	regulation of cellular metabolic process
GO:0071840	0.770	cellular component organization or biogenesis
GO:0048583	0.752	regulation of response to stimulus
GO:0010556	0.749	regulation of macromolecule biosynthetic process
GO:0031326	0.747	regulation of cellular biosynthetic process
GO:0016043	0.726	cellular component organization
GO:0019219	0.700	regulation of nucleobase-containing compound metabolic process
GO:0009605	0.695	response to external stimulus
GO:0051252	0.687	regulation of RNA metabolic process
GO:0043280	0.683	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006950	0.662	response to stress
GO:0048522	0.648	positive regulation of cellular process
GO:0006355	0.646	regulation of DNA-templated transcription
GO:0044419	0.634	biological process involved in interspecies interaction between organisms
GO:0051716	0.628	cellular response to stimulus
GO:0051707	0.612	response to other organism
GO:0006952	0.609	defense response
GO:0044092	0.569	negative regulation of molecular function
GO:0080134	0.567	regulation of response to stress
GO:0051090	0.547	regulation of DNA-binding transcription factor activity
GO:0032101	0.507	regulation of response to external stimulus
GO:0031347	0.481	regulation of defense response
GO:0032501	0.464	multicellular organismal process
GO:0048519	0.458	negative regulation of biological process
GO:0010605	0.446	negative regulation of macromolecule metabolic process
GO:0010646	0.422	regulation of cell communication
GO:0023051	0.420	regulation of signaling
GO:0022607	0.418	cellular component assembly
GO:0008152	0.415	metabolic process
GO:0042221	0.411	response to chemical
GO:0012501	0.398	programmed cell death
GO:0070887	0.396	cellular response to chemical stimulus
GO:0065003	0.389	protein-containing complex assembly
GO:0048523	0.385	negative regulation of cellular process
GO:0010033	0.384	response to organic substance
GO:0098542	0.381	defense response to other organism
GO:0048584	0.372	positive regulation of response to stimulus
GO:0031349	0.359	positive regulation of defense response
GO:0032103	0.353	positive regulation of response to external stimulus
GO:0071704	0.348	organic substance metabolic process
GO:0009966	0.344	regulation of signal transduction
GO:0050727	0.343	regulation of inflammatory response
GO:0002376	0.341	immune system process
GO:0006955	0.322	immune response
GO:0071310	0.321	cellular response to organic substance
GO:0009617	0.319	response to bacterium
GO:0043433	0.318	negative regulation of DNA-binding transcription factor activity
GO:0048585	0.316	negative regulation of response to stimulus
GO:0044238	0.303	primary metabolic process
GO:0006807	0.301	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0032991	0.977	protein-containing complex
GO:0043226	0.907	organelle
GO:0061702	0.887	inflammasome complex
GO:0043229	0.886	intracellular organelle
GO:0043231	0.851	intracellular membrane-bounded organelle
GO:0012505	0.479	endomembrane system
GO:0005654	0.369	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.389	Hydrolases.
RHEA:13065	0.322	ATP + H2O = ADP + H(+) + phosphate

[back to server]