StarFunc result for job id Q7RTR2

User Input

>input (1065 residues)
MRKQEVRTGREAGQGHGTGSPAEQVKALMDLLAGKGSQGSQAPQALDRTPDAPLGPCSND
SRIQRHRKALLSKVGGGPELGGPWHRLASLLLVEGLTDLQLREHDFTQVEATRGGGHPAR
TVALDRLFLPLSRVSVPPRVSITIGVAGMGKTTLVRHFVRLWAHGQVGKDFSLVLPLTFR
DLNTHEKLCADRLICSVFPHVGEPSLAVAVPARALLILDGLDECRTPLDFSNTVACTDPK
KEIPVDHLITNIIRGNLFPEVSIWITSRPSASGQIPGGLVDRMTEIRGFNEEEIKVCLEQ
MFPEDQALLGWMLSQVQADRALYLMCTVPAFCRLTGMALGHLWRSRTGPQDAELWPPRTL
CELYSWYFRMALSGEGQEKGKASPRIEQVAHGGRKMVGTLGRLAFHGLLKKKYVFYEQDM
KAFGVDLALLQGAPCSCFLQREETLASSVAYCFTHLSLQEFVAAAYYYGASRRAIFDLFT
ESGVSWPRLGFLTHFRSAAQRAMQAEDGRLDVFLRFLSGLLSPRVNALLAGSLLAQGEHQ
AYRTQVAELLQGCLRPDAAVCARAINVLHCLHELQHTELARSVEEAMESGALARLTGPAH
RAALAYLLQVSDACAQEANLSLSLSQGVLQSLLPQLLYCRKLRLDTNQFQDPVMELLGSV
LSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKI
NRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSL
KELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLS
LRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWN
FIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGA
SGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAI
CIATALSGNHRLQHINLQGNHIGDSGARMISEAIKTNAPTCTVEM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H3BLT9	0.954	0.914	0.000	1112	1.000	0.958	H3BLT9.pdb.gz	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
2	AFDB:Q5DU56	0.907	0.908	0.000	1064	0.790	0.790	Q5DU56.pdb.gz	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
3	AFDB:P59046	0.398	0.399	3.513E-49	1061	0.236	0.237	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
4	AFDB:Q86W24	0.388	0.379	6.379E-49	1093	0.223	0.217	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
5	AFDB:E9Q5R7	0.374	0.377	4.765E-47	1054	0.225	0.228	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
6	AFDB:P59047	0.409	0.368	2.355E-45	1200	0.229	0.203	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
7	AFDB:F1MT67	0.394	0.384	4.688E-45	1098	0.238	0.230	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
8	AFDB:Q96P20	0.284	0.290	1.062E-43	1036	0.212	0.218	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
9	AFDB:D4A523	0.350	0.358	2.784E-43	1035	0.211	0.217	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
10	AFDB:Q9R1M5	0.414	0.382	1.452E-42	1163	0.214	0.196	Q9R1M5.pdb.gz	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
11	PDB:7pzcA	0.385	0.403	9.225E-31	1010	0.204	0.215	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.341	0.432	4.837E-25	806	0.197	0.261	7lfhA.pdb.gz
13	PDB:6npyA	0.362	0.462	8.389E-25	798	0.183	0.244	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:4kxfP	0.306	0.367	1.523E-24	866	0.150	0.185	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
15	PDB:1a4yA	0.337	0.723	9.755E-21	460	0.101	0.235	1a4yA.pdb.gz
16	PDB:3jblA	0.264	0.301	5.199E-17	909	0.162	0.189	3jblA.pdb.gz
17	PDB:6b5bA	0.313	0.283	2.840E-16	1199	0.163	0.145	6b5bA.pdb.gz
18	PDB:5yudA	0.284	0.250	4.991E-12	1238	0.156	0.134	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
19	PDB:6o60C	0.265	0.642	9.934E-12	389	0.081	0.221	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
20	PDB:1k5dC	0.262	0.750	6.176E-10	344	0.069	0.215	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C3VPR7	0.0	2164	1065	1.000	1.000	C3VPR7_HUMAN NLRC3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=2 SV=1
2	H3BLT9	0.0	2164	1112	1.000	0.958	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
3	Q5DU56	0.0	1665	1064	0.786	0.787	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
4	Q7RTR2	0.0	2164	1065	1.000	1.000	NLRC3_HUMAN NLR family CARD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
5	A0A0G2K4Z7	5.28e-58	219	1034	0.219	0.225	A0A0G2K4Z7_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=2
6	Q93ZV8	1.42e-55	206	605	0.141	0.248	Q93ZV8_ARATH RNI-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB2004 PE=1 SV=1
7	E9Q5R7	4.44e-55	211	1054	0.245	0.248	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
8	Q8K3Z0	1.86e-54	208	1020	0.209	0.219	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
9	Q9HC29	1.88e-54	209	1040	0.210	0.215	NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NOD2 PE=1 SV=1
10	Q86W24	2.65e-54	208	1093	0.221	0.215	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
11	Q80SY9	4.20e-54	207	1013	0.209	0.220	Q80SY9_MOUSE NOD2 OS=Mus musculus OX=10090 GN=Nod2 PE=2 SV=1
12	Q6E804	2.97e-52	201	1013	0.222	0.233	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
13	P59046	5.31e-51	198	1061	0.232	0.233	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
14	F8W3K2	1.70e-48	189	980	0.213	0.232	F8W3K2_DANRE NOD2a protein OS=Danio rerio OX=7955 GN=card15 PE=2 SV=1
15	Q8R4B8	7.04e-47	185	1033	0.212	0.219	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
16	D4A523	2.06e-46	183	1035	0.209	0.215	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
17	Q96P20	1.23e-45	181	1036	0.203	0.208	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
18	P59047	7.24e-45	179	1200	0.229	0.203	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
19	Q9Y239	8.48e-45	178	953	0.195	0.218	NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOD1 PE=1 SV=1
20	D4ADT7	4.31e-43	172	953	0.182	0.204	D4ADT7_RAT Nucleotide-binding oligomerization domain containing 1 OS=Rattus norvegicus OX=10116 GN=Nod1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	4.5e+02	12.5	AAA domain
2	PF20421 DHR-2_Lobe_C	31	15.9	DHR-2, Lobe C
3	PF00560 LRR_1	0.00036	31.4	Leucine Rich Repeat
4	PF12799 LRR_4	0.039	25.6	Leucine Rich repeats (2 copies)
5	PF13516 LRR_6	3.5e-59	202.9	Leucine Rich repeat
6	PF13855 LRR_8	0.092	23.8	Leucine rich repeat
7	PF05729 NACHT	7.1e-36	135.1	NACHT domain
8	PF17776 NLRC4_HD2	8.2e-16	70.2	NLRC4 helical domain HD2
9	PF17779 NOD2_WH	9.5e-09	46.7	NOD2 winged helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352039

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433623	0.970	TNF receptor-associated factor 6
2	9606.ENSP00000329967	0.957	Serine/threonine-protein kinase TBK1
3	9606.ENSP00000331288	0.935	Stimulator of interferon genes protein
4	9606.ENSP00000471896	0.933	Interferon regulatory factor 3
5	9606.ENSP00000428657	0.694	Baculoviral IAP repeat-containing protein 1
6	9606.ENSP00000247470	0.692	Apoptosis-associated speck-like protein containing a CARD
7	9606.ENSP00000385090	0.666	NLR family CARD domain-containing protein 4
8	9606.ENSP00000428579	0.649	NACHT domain- and WD repeat-containing protein 1
9	9606.ENSP00000390661	0.624	C-type lectin domain family 2 member L
10	9606.ENSP00000219596	0.597	Pyrin
11	9606.ENSP00000327255	0.577	Protein phosphatase 1A
12	9606.ENSP00000343248	0.556	Serine/threonine-protein kinase SBK1
13	9606.ENSP00000204679	0.548	N-acetylglucosamine-1-phosphotransferase subunit gamma
14	9606.ENSP00000340299	0.543	Probable palmitoyltransferase ZDHHC1
15	9606.ENSP00000309501	0.532	NACHT and WD repeat domain containing 2
16	9606.ENSP00000433138	0.530	Caspase-1
17	9606.ENSP00000386710	0.520	Autophagy-related protein 9A
18	9606.ENSP00000435010	0.506	Beta-defensin 134
19	9606.ENSP00000290649	0.501	E3 ubiquitin-protein ligase AMFR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043548	0.616	phosphatidylinositol 3-kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0010468	0.991	regulation of gene expression
GO:0050896	0.989	response to stimulus
GO:0009987	0.988	cellular process
GO:0051716	0.983	cellular response to stimulus
GO:0001817	0.980	regulation of cytokine production
GO:0051252	0.977	regulation of RNA metabolic process
GO:0006355	0.972	regulation of DNA-templated transcription
GO:0043122	0.967	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0035556	0.960	intracellular signal transduction
GO:0032675	0.956	regulation of interleukin-6 production
GO:0043433	0.955	negative regulation of DNA-binding transcription factor activity
GO:0031347	0.944	regulation of defense response
GO:0032101	0.931	regulation of response to external stimulus
GO:0048519	0.927	negative regulation of biological process
GO:0002376	0.919	immune system process
GO:0007249	0.914	I-kappaB kinase/NF-kappaB signaling
GO:0032715	0.907	negative regulation of interleukin-6 production
GO:0048518	0.897	positive regulation of biological process
GO:0048523	0.884	negative regulation of cellular process
GO:0009605	0.866	response to external stimulus
GO:0043124	0.859	negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051707	0.846	response to other organism
GO:0032680	0.831	regulation of tumor necrosis factor production
GO:0050727	0.830	regulation of inflammatory response
GO:0032102	0.814	negative regulation of response to external stimulus
GO:0002682	0.807	regulation of immune system process
GO:0048522	0.786	positive regulation of cellular process
GO:0009893	0.782	positive regulation of metabolic process
GO:0010604	0.770	positive regulation of macromolecule metabolic process
GO:0050728	0.739	negative regulation of inflammatory response
GO:0048584	0.723	positive regulation of response to stimulus
GO:0006950	0.620	response to stress
GO:0042221	0.550	response to chemical
GO:0045088	0.546	regulation of innate immune response
GO:1903556	0.541	negative regulation of tumor necrosis factor superfamily cytokine production
GO:0010033	0.537	response to organic substance
GO:0010628	0.508	positive regulation of gene expression
GO:0051246	0.500	regulation of protein metabolic process
GO:0006952	0.498	defense response
GO:0051240	0.496	positive regulation of multicellular organismal process
GO:1901222	0.495	regulation of NIK/NF-kappaB signaling
GO:0032479	0.477	regulation of type I interferon production
GO:0008152	0.473	metabolic process
GO:0001819	0.467	positive regulation of cytokine production
GO:0098542	0.430	defense response to other organism
GO:0009617	0.426	response to bacterium
GO:0070887	0.415	cellular response to chemical stimulus
GO:0032088	0.409	negative regulation of NF-kappaB transcription factor activity
GO:0006955	0.394	immune response
GO:0071310	0.394	cellular response to organic substance
GO:0071704	0.389	organic substance metabolic process
GO:0032720	0.389	negative regulation of tumor necrosis factor production
GO:0051173	0.386	positive regulation of nitrogen compound metabolic process
GO:0009967	0.368	positive regulation of signal transduction
GO:1902533	0.358	positive regulation of intracellular signal transduction
GO:0045087	0.342	innate immune response
GO:0032651	0.335	regulation of interleukin-1 beta production
GO:0044238	0.325	primary metabolic process
GO:0002684	0.320	positive regulation of immune system process
GO:0031349	0.314	positive regulation of defense response
GO:0032103	0.300	positive regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0034451	0.989	centriolar satellite
GO:0005634	0.748	nucleus
GO:0016020	0.336	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]