StarFunc result for job id Q7RTT9

User Input

>input (530 residues)
MGSVGSQRLEEPSVAGTPDPGVVMSFTFDSHQLEEAAEAAQGQGLRARGVPAFTDTTLDE
PVPDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAV
LLNNVLVERLTLHTRITAGYLLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGC
TVQQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTLIFFLVSVA
LELLCFLLHLLVRRSRFVLFYTTRPRDSHRGRPGLGRGYGYRVHHDVVAGDVHFEHPAPA
LAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLHRYVVARVIWADMLSI
AVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWRGTHLLAC
SCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQR
ELAGNTMTVSYMSGLTLGSAVAYCTYSLTRDAHGSCLHASTANGSILAGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7RTT9	1.000	1.000	1.241E-62	530	1.000	1.000	Q7RTT9.pdb.gz	S29A4_HUMAN Equilibrative nucleoside transporter 4 OS=Homo sapiens OX=9606 GN=SLC29A4 PE=1 SV=1
2	AFDB:Q8R139	0.857	0.860	1.114E-53	528	0.870	0.873	Q8R139.pdb.gz	S29A4_MOUSE Equilibrative nucleoside transporter 4 OS=Mus musculus OX=10090 GN=Slc29a4 PE=1 SV=1
3	AFDB:Q8VXY7	0.684	0.801	1.951E-19	450	0.242	0.284	Q8VXY7.pdb.gz	ENT1_ARATH Equilibrative nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ENT1 PE=1 SV=1
4	AFDB:Q9BZD2	0.665	0.737	1.706E-18	475	0.219	0.244	Q9BZD2.pdb.gz	S29A3_HUMAN Equilibrative nucleoside transporter 3 OS=Homo sapiens OX=9606 GN=SLC29A3 PE=1 SV=3
5	AFDB:Q14542	0.658	0.760	3.256E-18	456	0.211	0.246	Q14542.pdb.gz	S29A2_HUMAN Equilibrative nucleoside transporter 2 OS=Homo sapiens OX=9606 GN=SLC29A2 PE=1 SV=3
6	AFDB:O54699	0.654	0.757	5.140E-18	456	0.226	0.263	O54699.pdb.gz	S29A2_RAT Equilibrative nucleoside transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc29a2 PE=1 SV=1
7	AFDB:Q80WK7	0.656	0.728	5.984E-18	475	0.221	0.246	Q80WK7.pdb.gz	S29A3_RAT Equilibrative nucleoside transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc29a3 PE=1 SV=2
8	AFDB:Q9JIM1	0.650	0.745	3.442E-17	460	0.228	0.263	Q9JIM1.pdb.gz	S29A1_MOUSE Equilibrative nucleoside transporter 1 OS=Mus musculus OX=10090 GN=Slc29a1 PE=1 SV=3
9	AFDB:Q99808	0.649	0.750	2.395E-16	456	0.204	0.237	Q99808.pdb.gz	S29A1_HUMAN Equilibrative nucleoside transporter 1 OS=Homo sapiens OX=9606 GN=SLC29A1 PE=1 SV=3
10	AFDB:Q4QH25	0.635	0.612	6.439E-16	550	0.181	0.175	Q4QH25.pdb.gz	Q4QH25_LEIMA Nucleobase transporter OS=Leishmania major OX=5664 GN=NT4 PE=3 SV=1
11	PDB:6ob7A	0.643	0.886	1.096E-15	381	0.187	0.260	6ob7A.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
12	PDB:6ob6B	0.629	0.924	2.630E-15	357	0.183	0.272	6ob6B.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
13	PDB:7c76B	0.499	0.540	8.605E-6	483	0.119	0.130	7c76B.pdb.gz
14	PDB:7aaqA	0.437	0.469	4.587E-5	487	0.123	0.133	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
15	PDB:7sptA	0.383	0.422	5.142E-5	470	0.119	0.134	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
16	PDB:3o7qA	0.483	0.595	1.233E-4	414	0.117	0.150	3o7qA.pdb.gz
17	PDB:6oopA	0.467	0.600	1.549E-4	392	0.109	0.148	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
18	PDB:7oixB	0.520	0.598	1.737E-4	451	0.121	0.142	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.
19	PDB:6s4mA	0.451	0.541	1.874E-4	426	0.147	0.183	6s4mA.pdb.gz
20	PDB:6thaA	0.479	0.548	2.266E-4	448	0.115	0.136	6thaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M2Y4	0.0	905	523	0.868	0.880	F1M2Y4_RAT Solute carrier family 29 member 4 OS=Rattus norvegicus OX=10116 GN=Slc29a4 PE=3 SV=2
2	Q7RTT9	0.0	1078	530	1.000	1.000	S29A4_HUMAN Equilibrative nucleoside transporter 4 OS=Homo sapiens OX=9606 GN=SLC29A4 PE=1 SV=1
3	Q8R139	0.0	913	528	0.874	0.877	S29A4_MOUSE Equilibrative nucleoside transporter 4 OS=Mus musculus OX=10090 GN=Slc29a4 PE=1 SV=1
4	Q8VXY7	4.63e-38	147	450	0.266	0.313	ENT1_ARATH Equilibrative nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ENT1 PE=1 SV=1
5	O54698	1.28e-28	120	457	0.240	0.278	S29A1_RAT Equilibrative nucleoside transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc29a1 PE=1 SV=3
6	O54699	1.42e-24	108	456	0.225	0.261	S29A2_RAT Equilibrative nucleoside transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc29a2 PE=1 SV=1
7	Q9JIM1	2.50e-24	108	460	0.234	0.270	S29A1_MOUSE Equilibrative nucleoside transporter 1 OS=Mus musculus OX=10090 GN=Slc29a1 PE=1 SV=3
8	Q61672	1.01e-23	106	456	0.219	0.254	S29A2_MOUSE Equilibrative nucleoside transporter 2 OS=Mus musculus OX=10090 GN=Slc29a2 PE=2 SV=2
9	Q80WK7	2.65e-22	102	475	0.217	0.242	S29A3_RAT Equilibrative nucleoside transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc29a3 PE=1 SV=2
10	Q14542	2.74e-22	102	456	0.223	0.259	S29A2_HUMAN Equilibrative nucleoside transporter 2 OS=Homo sapiens OX=9606 GN=SLC29A2 PE=1 SV=3
11	Q9BZD2	2.75e-21	99.0	475	0.242	0.269	S29A3_HUMAN Equilibrative nucleoside transporter 3 OS=Homo sapiens OX=9606 GN=SLC29A3 PE=1 SV=3
12	Q99808	1.87e-19	93.2	456	0.228	0.265	S29A1_HUMAN Equilibrative nucleoside transporter 1 OS=Homo sapiens OX=9606 GN=SLC29A1 PE=1 SV=3
13	G5EDJ3	1.50e-16	84.3	445	0.187	0.222	G5EDJ3_CAEEL Equilibrative nucleoside transporter 1 OS=Caenorhabditis elegans OX=6239 GN=ent-1 PE=1 SV=1
14	Q586N1	1.79e-15	81.3	462	0.170	0.195	Q586N1_TRYB2 Adenosine transporter 2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=36E18.110 PE=3 SV=1
15	A0A2R8YDR8	4.32e-14	76.3	397	0.189	0.252	A0A2R8YDR8_HUMAN Solute carrier family 29 member 3 OS=Homo sapiens OX=9606 GN=SLC29A3 PE=1 SV=1
16	Q93871	4.62e-14	76.6	450	0.189	0.222	Q93871_CAEEL Equilibrative nucleoside transporter 3 OS=Caenorhabditis elegans OX=6239 GN=ent-2 PE=1 SV=1
17	Q581D7	5.36e-14	76.6	463	0.145	0.166	Q581D7_TRYB2 Adenosine transporter 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28F21.780 PE=3 SV=1
18	Q4QG33	1.17e-13	75.5	501	0.208	0.220	Q4QG33_LEIMA Nucleobase transporter OS=Leishmania major OX=5664 GN=NT3 PE=3 SV=1
19	Q9VMB6	2.82e-13	74.3	458	0.209	0.242	Q9VMB6_DROME Equilibrative nucleoside transporter 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Ent2 PE=1 SV=1
20	Q586M9	3.52e-12	70.9	463	0.168	0.192	Q586M9_TRYB2 Adenosine transporter 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=36E18.120 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01733 Nucleoside_tran	2.4e-43	160.3	Nucleoside transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380081

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298472	0.820	Synaptic vesicular amine transporter
2	9606.ENSP00000270570	0.745	Multidrug and toxin extrusion protein 1
3	9606.ENSP00000275300	0.738	Solute carrier family 22 member 3
4	9606.ENSP00000326671	0.716	Multidrug and toxin extrusion protein 2
5	9606.ENSP00000315006	0.703	Sodium/nucleoside cotransporter 2
6	9606.ENSP00000365413	0.691	Solute carrier family 28 member 3
7	9606.ENSP00000378074	0.690	Sodium/nucleoside cotransporter 1
8	9606.ENSP00000355930	0.688	Solute carrier family 22 member 1
9	9606.ENSP00000261707	0.687	Sodium-dependent serotonin transporter
10	9606.ENSP00000355920	0.635	Solute carrier family 22 member 2
11	9606.ENSP00000357840	0.625	Sodium-dependent glucose transporter 1
12	9606.ENSP00000363345	0.621	Thymic stromal cotransporter homolog
13	9606.ENSP00000370192	0.617	Solute carrier family 46 member 3
14	9606.ENSP00000332646	0.609	Major facilitator superfamily domain-containing protein 10
15	9606.ENSP00000356256	0.606	Mitochondrial import inner membrane translocase subunit Tim17-A
16	9606.ENSP00000200652	0.603	Solute carrier family 22 member 4
17	9606.ENSP00000258436	0.599	Major facilitator superfamily domain containing 9
18	9606.ENSP00000219833	0.574	Sodium-dependent noradrenaline transporter
19	9606.ENSP00000270349	0.565	Sodium-dependent dopamine transporter
20	9606.ENSP00000301327	0.537	Major facilitator superfamily domain containing 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005326	1.000	neurotransmitter transmembrane transporter activity
GO:0008504	1.000	monoamine transmembrane transporter activity
GO:0005337	0.990	nucleoside transmembrane transporter activity
GO:0015101	0.711	organic cation transmembrane transporter activity
GO:0015075	0.645	monoatomic ion transmembrane transporter activity
GO:0008324	0.627	monoatomic cation transmembrane transporter activity
GO:0042910	0.476	xenobiotic transmembrane transporter activity
GO:0005515	0.435	protein binding
GO:0015291	0.408	secondary active transmembrane transporter activity
GO:0015562	0.337	efflux transmembrane transporter activity
GO:0015318	0.323	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071702	0.995	organic substance transport
GO:0071705	0.992	nitrogen compound transport
GO:0009987	0.975	cellular process
GO:0015844	0.923	monoamine transport
GO:0098657	0.749	import into cell
GO:0055085	0.730	transmembrane transport
GO:0006836	0.726	neurotransmitter transport
GO:0042908	0.715	xenobiotic transport
GO:0065007	0.670	biological regulation
GO:0001505	0.660	regulation of neurotransmitter levels
GO:0015695	0.558	organic cation transport
GO:0001504	0.504	neurotransmitter uptake
GO:0015850	0.497	organic hydroxy compound transport
GO:0008152	0.370	metabolic process
GO:0051937	0.353	catecholamine transport
GO:0090494	0.313	dopamine uptake
GO:0044237	0.308	cellular metabolic process
GO:0051649	0.303	establishment of localization in cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016324	1.000	apical plasma membrane
GO:0016323	1.000	basolateral plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]