StarFunc result for job id Q7RTU1

User Input

>input (214 residues)
MSQRKARGPPAMPGVGHSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRATP
GPRGTRAGGLALGRSEASPENAARERSRVRTLRQAFLALQAALPAVPPDTKLSKLDVLVL
AASYIAHLTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRLYAGGLGYSDLDSTTAST
PSQRTRDAEVGSQVPGEADALLSTTPLSPALGDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7RTU1	1.000	1.000	3.092E-32	214	1.000	1.000	Q7RTU1.pdb.gz	TCF23_HUMAN Transcription factor 23 OS=Homo sapiens OX=9606 GN=TCF23 PE=1 SV=1
2	AFDB:Q9JLR5	0.534	0.546	1.827E-21	209	0.771	0.789	Q9JLR5.pdb.gz	TCF23_MOUSE Transcription factor 23 OS=Mus musculus OX=10090 GN=Tcf23 PE=1 SV=1
3	AFDB:Q7RTU0	0.296	0.372	6.165E-8	167	0.402	0.515	Q7RTU0.pdb.gz	TCF24_HUMAN Transcription factor 24 OS=Homo sapiens OX=9606 GN=TCF24 PE=1 SV=3
4	AFDB:O88940	0.250	0.265	1.426E-6	201	0.276	0.294	O88940.pdb.gz	MUSC_MOUSE Musculin OS=Mus musculus OX=10090 GN=Msc PE=1 SV=1
5	AFDB:O60682	0.278	0.288	2.539E-5	206	0.266	0.277	O60682.pdb.gz	MUSC_HUMAN Musculin OS=Homo sapiens OX=9606 GN=MSC PE=1 SV=2
6	AFDB:Q32PV5	0.267	0.321	1.808E-4	176	0.229	0.278	Q32PV5.pdb.gz	TCF21_DANRE Transcription factor 21 OS=Danio rerio OX=7955 GN=tcf21 PE=2 SV=1
7	AFDB:O42202	0.254	0.158	7.630E-4	350	0.192	0.117	O42202.pdb.gz	NDF1_DANRE Neurogenic differentiation factor 1 OS=Danio rerio OX=7955 GN=neurod1 PE=1 SV=1
8	AFDB:Q90690	0.256	0.253	1.206E-3	216	0.220	0.218	Q90690.pdb.gz	HAND2_CHICK Heart- and neural crest derivatives-expressed protein 2 OS=Gallus gallus OX=9031 GN=HAND2 PE=2 SV=1
9	AFDB:O35437	0.255	0.304	1.288E-3	179	0.224	0.268	O35437.pdb.gz	TCF21_MOUSE Transcription factor 21 OS=Mus musculus OX=10090 GN=Tcf21 PE=2 SV=1
10	AFDB:P97832	0.277	0.275	1.907E-3	216	0.201	0.199	P97832.pdb.gz	HAND1_RAT Heart- and neural crest derivatives-expressed protein 1 OS=Rattus norvegicus OX=10116 GN=Hand1 PE=2 SV=2
11	PDB:4v6wCh	0.114	0.176	2.715	123	0.084	0.146	4v6wCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	PDB:7kuyE	0.117	0.079	2.715	338	0.042	0.027	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
13	PDB:5apnh	0.127	0.217	3.766	119	0.079	0.143	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
14	PDB:2qbyA	0.139	0.085	4.583	366	0.028	0.016	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
15	PDB:6zx9C	0.114	0.099	4.583	257	0.051	0.043	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
16	PDB:2cz3A	0.084	0.093	4.893	191	0.042	0.047	2cz3A.pdb.gz
17	PDB:3dofB	0.097	0.152	4.893	120	0.061	0.108	3dofB.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
18	PDB:7py4A	0.092	0.026	5.224	1112	0.070	0.013	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
19	PDB:6dv9F	0.084	0.096	5.577	174	0.093	0.115	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
20	PDB:5lsjA	0.146	0.155	5.954	199	0.023	0.025	5lsjA.pdb.gz	Structure of the MIS12 Complex and Molecular Basis of Its Interaction with CENP-C at Human Kinetochores.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7RTU1	5.19e-151	419	214	1.000	1.000	TCF23_HUMAN Transcription factor 23 OS=Homo sapiens OX=9606 GN=TCF23 PE=1 SV=1
2	Q9JLR5	2.02e-109	314	209	0.771	0.789	TCF23_MOUSE Transcription factor 23 OS=Mus musculus OX=10090 GN=Tcf23 PE=1 SV=1
3	Q7RTU0	6.69e-34	120	167	0.294	0.377	TCF24_HUMAN Transcription factor 24 OS=Homo sapiens OX=9606 GN=TCF24 PE=1 SV=3
4	Q32PV5	4.80e-15	72.0	176	0.206	0.250	TCF21_DANRE Transcription factor 21 OS=Danio rerio OX=7955 GN=tcf21 PE=2 SV=1
5	Q6GNB7	1.47e-14	70.9	179	0.182	0.218	TCF21_XENLA Transcription factor 21 OS=Xenopus laevis OX=8355 GN=tcf21 PE=2 SV=1
6	O35437	1.48e-14	70.9	179	0.182	0.218	TCF21_MOUSE Transcription factor 21 OS=Mus musculus OX=10090 GN=Tcf21 PE=2 SV=1
7	Q498R2	1.53e-14	70.9	179	0.182	0.218	Q498R2_RAT Transcription factor 21 OS=Rattus norvegicus OX=10116 GN=Tcf21 PE=4 SV=1
8	O43680	1.58e-14	70.9	179	0.182	0.218	TCF21_HUMAN Transcription factor 21 OS=Homo sapiens OX=9606 GN=TCF21 PE=1 SV=2
9	O60682	3.12e-13	67.8	206	0.182	0.189	MUSC_HUMAN Musculin OS=Homo sapiens OX=9606 GN=MSC PE=1 SV=2
10	O88940	1.07e-12	66.2	201	0.178	0.189	MUSC_MOUSE Musculin OS=Mus musculus OX=10090 GN=Msc PE=1 SV=1
11	A0A2R8QBT6	3.39e-11	61.2	160	0.168	0.225	A0A2R8QBT6_DANRE Musculin OS=Danio rerio OX=7955 GN=msc PE=4 SV=1
12	Q9QYC3	6.87e-09	55.8	197	0.154	0.168	BHA15_MOUSE Class A basic helix-loop-helix protein 15 OS=Mus musculus OX=10090 GN=Bhlha15 PE=1 SV=1
13	P70562	7.74e-09	55.5	197	0.154	0.168	BHA15_RAT Class A basic helix-loop-helix protein 15 OS=Rattus norvegicus OX=10116 GN=Bhlha15 PE=1 SV=1
14	Q02577	1.88e-08	53.5	135	0.117	0.185	HEN2_HUMAN Helix-loop-helix protein 2 OS=Homo sapiens OX=9606 GN=NHLH2 PE=1 SV=1
15	Q64221	2.00e-08	53.1	135	0.117	0.185	HEN2_MOUSE Helix-loop-helix protein 2 OS=Mus musculus OX=10090 GN=Nhlh2 PE=1 SV=2
16	Q02575	2.03e-08	53.1	133	0.117	0.188	HEN1_HUMAN Helix-loop-helix protein 1 OS=Homo sapiens OX=9606 GN=NHLH1 PE=1 SV=1
17	Q5T203	2.03e-08	53.1	133	0.117	0.188	Q5T203_HUMAN Nescient helix loop helix 1 OS=Homo sapiens OX=9606 GN=NHLH1 PE=1 SV=1
18	Q7RTU7	2.79e-08	54.3	201	0.140	0.149	SCX_HUMAN Basic helix-loop-helix transcription factor scleraxis OS=Homo sapiens OX=9606 GN=SCX PE=1 SV=1
19	Q60756	3.50e-08	53.9	195	0.121	0.133	TCF15_MOUSE Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2
20	P59101	3.64e-08	53.5	187	0.145	0.166	SCX_CHICK Basic helix-loop-helix transcription factor scleraxis OS=Gallus gallus OX=9031 GN=SCX PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	3.7e-08	44.6	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296096

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306817	0.706	Ribokinase
2	9606.ENSP00000233535	0.685	Zinc transporter 3
3	9606.ENSP00000333097	0.672	Factor in the germline alpha
4	9606.ENSP00000264833	0.654	Noelin-2
5	9606.ENSP00000388940	0.537	Transcription factor 12
6	9606.ENSP00000288861	0.533	Calcium and integrin binding family member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.762	DNA binding
GO:0043565	0.684	sequence-specific DNA binding
GO:0003690	0.677	double-stranded DNA binding
GO:1990837	0.633	sequence-specific double-stranded DNA binding
GO:0003700	0.596	DNA-binding transcription factor activity
GO:0000976	0.474	transcription cis-regulatory region binding
GO:0000977	0.371	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.347	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0050794	0.907	regulation of cellular process
GO:0019222	0.906	regulation of metabolic process
GO:0060255	0.901	regulation of macromolecule metabolic process
GO:0032502	0.878	developmental process
GO:0010468	0.854	regulation of gene expression
GO:0048518	0.848	positive regulation of biological process
GO:0032501	0.684	multicellular organismal process
GO:0009987	0.530	cellular process
GO:0010604	0.466	positive regulation of macromolecule metabolic process
GO:0048856	0.451	anatomical structure development
GO:0048522	0.335	positive regulation of cellular process
GO:0000003	0.331	reproduction
GO:0051171	0.312	regulation of nitrogen compound metabolic process
GO:0080090	0.311	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0043232	0.939	intracellular non-membrane-bounded organelle
GO:0005634	0.933	nucleus
GO:0005737	0.796	cytoplasm
GO:0005694	0.685	chromosome
GO:0000785	0.621	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]