StarFunc result for job id Q7RTU3

User Input

>input (272 residues)
MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAG
AKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRK
LSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHP
VHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCP
CTICQMPPPPHLSALSTANMARLSAESKDLLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PFG8	0.564	0.562	4.561E-36	273	0.985	0.982	Q6PFG8.pdb.gz	OLIG3_MOUSE Oligodendrocyte transcription factor 3 OS=Mus musculus OX=10090 GN=Olig3 PE=2 SV=1
2	AFDB:Q90XB3	0.394	0.362	4.241E-19	298	0.577	0.527	Q90XB3.pdb.gz	OLIG2_CHICK Oligodendrocyte transcription factor 2 OS=Gallus gallus OX=9031 GN=OLIG2 PE=2 SV=1
3	AFDB:A8WIQ8	0.369	0.367	8.871E-17	273	0.570	0.568	A8WIQ8.pdb.gz
4	AFDB:Q5K548	0.358	0.398	3.618E-14	244	0.426	0.475	Q5K548.pdb.gz	Q5K548_DANRE BHLH transcription factor 3 OS=Danio rerio OX=7955 GN=olig3 PE=2 SV=1
5	AFDB:F1R9F5	0.288	0.299	1.490E-5	261	0.257	0.268	F1R9F5.pdb.gz	F1R9F5_DANRE Basic helix-loop-helix family, member e22 OS=Danio rerio OX=7955 GN=Beta3.1 PE=4 SV=1
6	AFDB:Q8NFJ8	0.275	0.197	1.886E-4	381	0.272	0.194	Q8NFJ8.pdb.gz	BHE22_HUMAN Class E basic helix-loop-helix protein 22 OS=Homo sapiens OX=9606 GN=BHLHE22 PE=2 SV=1
7	AFDB:Q62414	0.225	0.163	2.304E-4	383	0.276	0.196	Q62414.pdb.gz	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
8	AFDB:Q9HD90	0.223	0.187	8.763E-4	331	0.261	0.215	Q9HD90.pdb.gz	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
9	AFDB:Q0VG99	0.184	0.129	1.001E-3	397	0.213	0.146	Q0VG99.pdb.gz	MESP2_HUMAN Mesoderm posterior protein 2 OS=Homo sapiens OX=9606 GN=MESP2 PE=1 SV=2
10	AFDB:Q2QMM0	0.251	0.257	1.071E-3	266	0.191	0.195	Q2QMM0.pdb.gz	Q2QMM0_ORYSJ Helix-loop-helix DNA-binding domain containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os12g40710 PE=3 SV=1
11	PDB:7pubCI	0.137	0.095	4.576	427	0.048	0.030	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
12	PDB:4v6xCh	0.141	0.290	5.591	123	0.037	0.081	4v6xCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:6lo8F	0.132	0.336	5.977	84	0.040	0.131	6lo8F.pdb.gz
14	PDB:7wtww	0.088	0.072	6.832	332	0.081	0.066	7wtww.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
15	PDB:7cgpJ	0.121	0.287	7.303	83	0.066	0.217	7cgpJ.pdb.gz
16	PDB:6k15J	0.109	0.124	7.808	235	0.048	0.055	6k15J.pdb.gz	Structure of the RSC complex bound to the nucleosome.
17	PDB:6lo8E	0.145	0.391	8.924	80	0.029	0.100	6lo8E.pdb.gz
18	PDB:7cpuLb	0.093	0.206	8.924	99	0.055	0.152	7cpuLb.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
19	PDB:7v2wI	0.109	0.123	8.924	240	0.059	0.067	7v2wI.pdb.gz
20	PDB:5b49B	0.094	0.102	9.540	247	0.040	0.045	5b49B.pdb.gz	Crystal structures of the UDP-diacylglucosamine pyrophosphohydrase LpxH from Pseudomonas aeruginosa

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PFG8	0.0	540	273	0.985	0.982	OLIG3_MOUSE Oligodendrocyte transcription factor 3 OS=Mus musculus OX=10090 GN=Olig3 PE=2 SV=1
2	Q7RTU3	0.0	550	272	1.000	1.000	OLIG3_HUMAN Oligodendrocyte transcription factor 3 OS=Homo sapiens OX=9606 GN=OLIG3 PE=1 SV=2
3	Q90XB3	2.25e-80	246	298	0.581	0.530	OLIG2_CHICK Oligodendrocyte transcription factor 2 OS=Gallus gallus OX=9031 GN=OLIG2 PE=2 SV=1
4	Q8QGI4	7.71e-73	226	273	0.526	0.524	Q8QGI4_DANRE BHLH transcription factor OS=Danio rerio OX=7955 GN=wu:fc64g09 PE=2 SV=1
5	Q9EQW6	6.21e-72	225	323	0.551	0.464	OLIG2_MOUSE Oligodendrocyte transcription factor 2 OS=Mus musculus OX=10090 GN=Olig2 PE=1 SV=1
6	G3V612	2.28e-71	224	323	0.548	0.461	G3V612_RAT Oligodendrocyte transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Olig2 PE=1 SV=1
7	Q13516	1.81e-69	219	323	0.548	0.461	OLIG2_HUMAN Oligodendrocyte transcription factor 2 OS=Homo sapiens OX=9606 GN=OLIG2 PE=1 SV=2
8	Q5K548	4.61e-53	174	244	0.379	0.422	Q5K548_DANRE BHLH transcription factor 3 OS=Danio rerio OX=7955 GN=olig3 PE=2 SV=1
9	Q90X21	4.73e-47	156	163	0.364	0.607	Q90X21_CHICK Olig2 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
10	Q8BGW3	1.65e-28	110	223	0.191	0.233	BHE23_MOUSE Class E basic helix-loop-helix protein 23 OS=Mus musculus OX=10090 GN=Bhlhe23 PE=2 SV=1
11	Q7T301	1.44e-27	108	238	0.213	0.244	Q7T301_DANRE Basic helix-loop-helix family, member e22 OS=Danio rerio OX=7955 GN=bhlhe22 PE=2 SV=1
12	Q8NDY6	1.65e-27	107	225	0.188	0.227	BHE23_HUMAN Class E basic helix-loop-helix protein 23 OS=Homo sapiens OX=9606 GN=BHLHE23 PE=1 SV=1
13	F1R9F5	3.10e-27	108	261	0.213	0.222	F1R9F5_DANRE Basic helix-loop-helix family, member e22 OS=Danio rerio OX=7955 GN=Beta3.1 PE=4 SV=1
14	Q8NFJ8	1.56e-26	108	381	0.188	0.134	BHE22_HUMAN Class E basic helix-loop-helix protein 22 OS=Homo sapiens OX=9606 GN=BHLHE22 PE=2 SV=1
15	Q9VJC1	3.89e-26	104	232	0.188	0.220	Q9VJC1_DROME GH17679p OS=Drosophila melanogaster OX=7227 GN=Oli PE=2 SV=1
16	Q8C6A8	4.11e-26	107	355	0.188	0.144	BHE22_MOUSE Class E basic helix-loop-helix protein 22 OS=Mus musculus OX=10090 GN=Bhlhe22 PE=1 SV=1
17	Q8TAK6	6.65e-24	99.4	271	0.199	0.199	OLIG1_HUMAN Oligodendrocyte transcription factor 1 OS=Homo sapiens OX=9606 GN=OLIG1 PE=1 SV=2
18	Q5QJR2	7.00e-24	98.6	235	0.195	0.226	Q5QJR2_DANRE Oligodendrocyte transcription factor 1 OS=Danio rerio OX=7955 GN=olig1 PE=4 SV=1
19	A8WIQ7	8.18e-24	98.2	235	0.195	0.226	A8WIQ7_DANRE Oligodendrocyte transcription factor 1 OS=Danio rerio OX=7955 GN=olig1 PE=4 SV=1
20	O45489	6.14e-22	89.7	101	0.162	0.436	HLH17_CAEEL Helix-loop-helix protein 17 OS=Caenorhabditis elegans OX=6239 GN=hlh-17 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	9e-09	46.5	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481570	0.629	Tumor necrosis factor alpha-induced protein 3
2	9606.ENSP00000362170	0.596	Nuclear apoptosis-inducing factor 1
3	9606.ENSP00000323302	0.595	POC1 centriolar protein homolog B
4	9606.ENSP00000362994	0.591	TNF receptor-associated factor 1
5	9606.ENSP00000410409	0.591	TATA box-binding protein-associated factor RNA polymerase I subunit D
6	9606.ENSP00000436881	0.589	Homeobox protein DBX1
7	9606.ENSP00000365437	0.568	Glutamate decarboxylase 2
8	9606.ENSP00000352833	0.556	Tyrosine-protein phosphatase non-receptor type 22
9	9606.ENSP00000262965	0.549	Transcription factor E2-alpha
10	9606.ENSP00000423630	0.545	F-box/LRR-repeat protein 7
11	9606.ENSP00000285873	0.542	Gem-associated protein 5
12	9606.ENSP00000370200	0.533	snRNA-activating protein complex subunit 3
13	9606.ENSP00000262811	0.514	Microtubule associated serine/threonine kinase 3
14	9606.ENSP00000366347	0.505	Homeobox protein Nkx-2.2
15	9606.ENSP00000388940	0.504	Transcription factor 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0003700	0.956	DNA-binding transcription factor activity
GO:0000976	0.900	transcription cis-regulatory region binding
GO:0000981	0.513	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.439	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.357	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0032501	0.988	multicellular organismal process
GO:0032502	0.986	developmental process
GO:0007417	0.983	central nervous system development
GO:0022008	0.979	neurogenesis
GO:0019222	0.976	regulation of metabolic process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0048699	0.973	generation of neurons
GO:0031323	0.955	regulation of cellular metabolic process
GO:0080090	0.945	regulation of primary metabolic process
GO:0010468	0.940	regulation of gene expression
GO:0019219	0.939	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.935	regulation of biosynthetic process
GO:0051252	0.934	regulation of RNA metabolic process
GO:1903506	0.920	regulation of nucleic acid-templated transcription
GO:0006355	0.907	regulation of DNA-templated transcription
GO:0001708	0.858	cell fate specification
GO:0048519	0.780	negative regulation of biological process
GO:0048523	0.738	negative regulation of cellular process
GO:0030182	0.731	neuron differentiation
GO:0048513	0.702	animal organ development
GO:0009892	0.697	negative regulation of metabolic process
GO:0021522	0.589	spinal cord motor neuron differentiation
GO:0048663	0.586	neuron fate commitment
GO:0051172	0.500	negative regulation of nitrogen compound metabolic process
GO:0031324	0.496	negative regulation of cellular metabolic process
GO:0010605	0.458	negative regulation of macromolecule metabolic process
GO:0048870	0.416	cell motility
GO:0045934	0.403	negative regulation of nucleobase-containing compound metabolic process
GO:0048518	0.376	positive regulation of biological process
GO:0051253	0.348	negative regulation of RNA metabolic process
GO:0048522	0.318	positive regulation of cellular process
GO:0010558	0.309	negative regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.792	cytoplasm
GO:0070013	0.412	intracellular organelle lumen
GO:0031981	0.369	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]