StarFunc result for job id Q7RTU9

User Input

>input (1775 residues)
MALSLWPLLLLLLLLLLLSFAVTLAPTGPHSLDPGLSFLKSLLSTLDQAPQGSLSRSRFF
TFLANISSSFEPGRMGEGPVGEPPPLQPPALRLHDFLVTLRGSPDWEPMLGLLGDMLALL
GQEQTPRDFLVHQAGVLGGLVEVLLGALVPGGPPTPTRPPCTRDGPSDCVLAADWLPSLL
LLLEGTRWQALVQVQPSVDPTNATGLDGREAAPHFLQGLLGLLTPTGELGSKEALWGGLL
RTVGAPLYAAFQEGLLRVTHSLQDEVFSILGQPEPDTNGQCQGGNLQQLLLWGVRHNLSW
DVQALGFLSGSPPPPPALLHCLSTGVPLPRASQPSAHISPRQRRAITVEALCENHLGPAP
PYSISNFSIHLLCQHTKPATPQPHPSTTAICQTAVWYAVSWAPGAQGWLQACHDQFPDEF
LDAICSNLSFSALSGSNRRLVKRLCAGLLPPPTSCPEGLPPVPLTPDIFWGCFLENETLW
AERLCGEASLQAVPPSNQAWVQHVCQGPTPDVTASPPCHIGPCGERCPDGGSFLVMVCAN
DTMYEVLVPFWPWLAGQCRISRGGNDTCFLEGLLGPLLPSLPPLGPSPLCLTPGPFLLGM
LSQLPRCQSSVPALAHPTRLHYLLRLLTFLLGPGAGGAEAQGMLGRALLLSSLPDNCSFW
DAFRPEGRRSVLRTIGEYLEQDEEQPTPSGFEPTVNPSSGISKMELLACFSPVLWDLLQR
EKSVWALQILVQAYLHMPPENLQQLVLSAEREAAQGFLTLMLQGKLQGKLQVPPSEEQAL
GRLTALLLQRYPRLTSQLFIDLSPLIPFLAVSDLMRFPPSLLANDSVLAAIRDYSPGMRP
EQKEALAKRLLAPELFGEVPAWPQELLWAVLPLLPHLPLENFLQLSPHQIQALEDSWPAA
GLGPGHARHVLRSLVNQSVQDGEEQVRRLGPLACFLSPEELQSLVPLSDPTGPVERGLLE
CAANGTLSPEGRVAYELLGVLRSSGGAVLSPRELRVWAPLFSQLGLRFLQELSEPQLRAM
LPVLQGTSVTPAQAVLLLGRLLPRHDLSLEELCSLHLLLPGLSPQTLQAIPRRVLVGACS
CLAPELSRLSACQTAALLQTFRVKDGVKNMGTTGAGPAVCIPGQPIPTTWPDCLLPLLPL
KLLQLDSLALLANRRRYWELPWSEQQAQFLWKKMQVPTNLTLRNLQALGTLAGGMSCEFL
QQINSMVDFLEVVHMIYQLPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKL
LLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGE
VLETLGPLVGFLGTESTRQIPLQILLSHLSQLQGFCLGETFATELGWLLLQESVLGKPEL
WSQDEVEQAGRLVFTLSTEAISLIPREALGPETLERLLEKQQSWEQSRVGQLCREPQLAA
KKAALVAGVVRPAAEDLPEPVPNCADVRGTFPAAWSATQIAEMELSDFEDCLTLFAGDPG
LGPEELRAAMGKAKQLWGPPRGFRPEQILQLGRLLIGLGDRELQELILVDWGVLSTLGQI
DGWSTTQLRIVVSSFLRQSGRHVSHLDFVHLTALGYTLCGLRPEELQHISSWEFSQAALF
LGTLHLQCSEEQLEVLAHLLVLPGGFGPISNWGPEIFTEIGTIAAGIPDLALSALLRGQI
QGVTPLAISVIPPPKFAVVFSPIQLSSLTSAQAVAVTPEQMAFLSPEQRRAVAWAQHEGK
ESPEQQGRSTAWGLQDWSRPSWSLVLTISFLGHLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1L378	0.524	0.913	0.000	1002	0.548	0.970	A1L378.pdb.gz	A1L378_HUMAN STRC protein OS=Homo sapiens OX=9606 GN=STRC PE=1 SV=1
2	AFDB:Q8VIM6	0.765	0.752	0.000	1809	0.875	0.859	Q8VIM6.pdb.gz	STRC_MOUSE Stereocilin OS=Mus musculus OX=10090 GN=Strc PE=2 SV=2
3	AFDB:Q7RTW8	0.392	0.575	1.074E-28	1153	0.126	0.193	Q7RTW8.pdb.gz	OTOAN_HUMAN Otoancorin OS=Homo sapiens OX=9606 GN=OTOA PE=1 SV=1
4	AFDB:Q8K561	0.397	0.587	1.671E-28	1137	0.127	0.198	Q8K561.pdb.gz	OTOAN_MOUSE Otoancorin OS=Mus musculus OX=10090 GN=Otoa PE=2 SV=1
5	PDB:7zf1B	0.079	0.096	2.795E-5	1179	0.081	0.122	7zf1B.pdb.gz
6	PDB:2xwuB	0.087	0.128	3.121E-5	910	0.077	0.149	2xwuB.pdb.gz
7	PDB:7su3A	0.085	0.053	3.238E-5	3802	0.117	0.054	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
8	PDB:7ajuUT	0.084	0.070	6.517E-5	2313	0.099	0.076	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
9	PDB:7w7gB	0.077	0.079	8.433E-5	1711	0.109	0.113	7w7gB.pdb.gz	Structure and mechanism of NALCN-FAM155A-UNC79-UNC80 channel complex.
10	PDB:7kzvV	0.084	0.105	1.412E-4	1155	0.080	0.123	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
11	PDB:7mqaSP	0.080	0.067	1.636E-4	2485	0.101	0.072	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7sqcR1	0.095	0.087	1.761E-4	2080	0.114	0.098	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:6h02A	0.085	0.098	2.041E-4	1334	0.094	0.124	6h02A.pdb.gz
14	PDB:6x9oA	0.081	0.070	2.545E-4	2425	0.118	0.087	6x9oA.pdb.gz
15	AFDB:Q9M033	0.082	0.094	3.249E-4	1467	0.094	0.114	Q9M033.pdb.gz	Q9M033_ARATH HEAT repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=ESP4 PE=1 SV=1
16	AFDB:Q9VVU6	0.100	0.147	7.578E-4	931	0.075	0.143	Q9VVU6.pdb.gz	Q9VVU6_DROME Pre-mRNA-processing factor 6 OS=Drosophila melanogaster OX=7227 GN=Prp6 PE=1 SV=2
17	AFDB:Q7Z494	0.071	0.084	1.179E-3	1330	0.120	0.160	Q7Z494.pdb.gz	NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens OX=9606 GN=NPHP3 PE=1 SV=1
18	AFDB:R4GLV5	0.069	0.088	1.316E-3	1116	0.105	0.167	R4GLV5.pdb.gz
19	AFDB:F8VQ70	0.052	0.061	3.557E-3	1398	0.119	0.152	F8VQ70.pdb.gz	F8VQ70_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1
20	AFDB:Q9BY12	0.048	0.056	7.161E-3	1400	0.094	0.119	Q9BY12.pdb.gz	SCAPE_HUMAN S phase cyclin A-associated protein in the endoplasmic reticulum OS=Homo sapiens OX=9606 GN=SCAPER PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L378	0.0	1245	1002	0.357	0.632	A1L378_HUMAN STRC protein OS=Homo sapiens OX=9606 GN=STRC PE=1 SV=1
2	Q8VIM6	0.0	2876	1809	0.867	0.851	STRC_MOUSE Stereocilin OS=Mus musculus OX=10090 GN=Strc PE=2 SV=2
3	Q8K561	5.77e-23	109	1137	0.049	0.077	OTOAN_MOUSE Otoancorin OS=Mus musculus OX=10090 GN=Otoa PE=2 SV=1
4	Q7RTW8	5.26e-19	96.7	1153	0.045	0.069	OTOAN_HUMAN Otoancorin OS=Homo sapiens OX=9606 GN=OTOA PE=1 SV=1
5	Q92823	1.0	36.6	1304	0.030	0.041	NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo sapiens OX=9606 GN=NRCAM PE=1 SV=3
6	Q79EM8	1.8	35.4	332	0.016	0.084	PHDJ_NOCSK Trans-2'-carboxybenzalpyruvate hydratase-aldolase OS=Nocardioides sp. (strain KP7) OX=102632 GN=phdJ PE=1 SV=1
7	Q9ERA7	2.4	35.4	625	0.041	0.115	MSLN_RAT Mesothelin OS=Rattus norvegicus OX=10116 GN=Msln PE=2 SV=2
8	E1U8C5	2.8	35.0	848	0.020	0.042	E1U8C5_PIG Signal transducer and activator of transcription OS=Sus scrofa OX=9823 GN=stat6 PE=2 SV=1
9	E5F1H4	2.8	35.0	847	0.020	0.043	E5F1H4_PIG Signal transducer and activator of transcription OS=Sus scrofa OX=9823 GN=STAT6 PE=2 SV=1
10	Q7Z7W6	4.2	34.7	759	0.020	0.046	KATG_ASPFU Catalase-peroxidase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=katG PE=1 SV=1
11	B8LFF6	5.1	34.3	1414	0.014	0.018	B8LFF6_DANRE Receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=erbb4 PE=2 SV=1
12	Q8CAS9	5.3	34.3	866	0.016	0.033	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
13	P32069	5.7	34.3	621	0.019	0.055	TRPX_ARATH Anthranilate synthase alpha subunit 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASA2 PE=2 SV=1
14	Q2G1M6	6.5	33.9	400	0.007	0.033	SBNH_STAA8 2-[(L-alanin-3-ylcarbamoyl)methyl]-2-hydroxybutanedioate decarboxylase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=sbnH PE=1 SV=1
15	A0A1D8PFD4	9.4	30.4	67	0.010	0.269	A0A1D8PFD4_CANAL F1F0 ATP synthase subunit k OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP19 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15494 SRCR_2	4.6e+02	12.9	Scavenger receptor cysteine-rich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371180	0.967	Cation channel sperm-associated protein 2
2	9606.ENSP00000406577	0.901	Creatine kinase U-type, mitochondrial
3	9606.ENSP00000300283	0.880	Creatine kinase, mitochondrial 1B
4	9606.ENSP00000400887	0.818	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1
5	9606.ENSP00000324775	0.812	Transmembrane inner ear expressed protein
6	9606.ENSP00000358430	0.770	Beta-tectorin
7	9606.ENSP00000348564	0.765	Codanin-1
8	9606.ENSP00000400895	0.747	Otogelin-like protein
9	9606.ENSP00000386647	0.736	Pejvakin
10	9606.ENSP00000382323	0.735	Otogelin
11	9606.ENSP00000482885	0.728	Phosphatidylinositol phosphatase PTPRQ
12	9606.ENSP00000205890	0.726	Unconventional myosin-XV
13	9606.ENSP00000272371	0.720	Otoferlin
14	9606.ENSP00000297784	0.702	Transmembrane channel-like protein 1
15	9606.ENSP00000372295	0.702	Gap junction beta-2 protein
16	9606.ENSP00000382090	0.701	Claudin-14
17	9606.ENSP00000381768	0.689	Cadherin-23
18	9606.ENSP00000363068	0.678	Protocadherin-15
19	9606.ENSP00000283228	0.674	Receptor-type tyrosine-protein phosphatase R
20	9606.ENSP00000363139	0.669	CD164 molecule like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.986	multicellular organismal process
GO:0009987	0.979	cellular process
GO:0007605	0.979	sensory perception of sound
GO:0016043	0.940	cellular component organization
GO:0032502	0.825	developmental process
GO:0048856	0.824	anatomical structure development
GO:0009612	0.813	response to mechanical stimulus
GO:0008544	0.805	epidermis development
GO:0048839	0.803	inner ear development
GO:0030855	0.782	epithelial cell differentiation
GO:0031175	0.756	neuron projection development
GO:0009913	0.731	epidermal cell differentiation
GO:0009887	0.728	animal organ morphogenesis
GO:0009790	0.728	embryo development
GO:0042490	0.722	mechanoreceptor differentiation
GO:0035315	0.722	hair cell differentiation
GO:0060119	0.688	inner ear receptor cell development
GO:0042491	0.688	inner ear auditory receptor cell differentiation
GO:0060122	0.682	inner ear receptor cell stereocilium organization
GO:0060117	0.682	auditory receptor cell development
GO:0009582	0.678	detection of abiotic stimulus
GO:0009581	0.678	detection of external stimulus
GO:0050906	0.678	detection of stimulus involved in sensory perception
GO:0050974	0.643	detection of mechanical stimulus involved in sensory perception
GO:0042472	0.635	inner ear morphogenesis
GO:0050910	0.595	detection of mechanical stimulus involved in sensory perception of sound
GO:0048667	0.593	cell morphogenesis involved in neuron differentiation
GO:0002093	0.564	auditory receptor cell morphogenesis
GO:0065007	0.360	biological regulation
GO:0050789	0.336	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0120025	0.995	plasma membrane bounded cell projection
GO:0043005	0.989	neuron projection
GO:0098858	0.985	actin-based cell projection
GO:0097730	0.978	non-motile cilium
GO:0032426	0.977	stereocilium tip
GO:0016020	0.972	membrane
GO:0005622	0.969	intracellular anatomical structure
GO:0071944	0.955	cell periphery
GO:0043229	0.943	intracellular organelle
GO:0043231	0.918	intracellular membrane-bounded organelle
GO:0005886	0.842	plasma membrane
GO:0060091	0.725	kinocilium
GO:0005737	0.666	cytoplasm
GO:0012505	0.542	endomembrane system
GO:0031974	0.487	membrane-enclosed lumen
GO:0043233	0.482	organelle lumen
GO:0070013	0.465	intracellular organelle lumen
GO:0031981	0.406	nuclear lumen
GO:0005654	0.361	nucleoplasm
GO:0005576	0.338	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]