StarFunc result for job id Q7RTV5

User Input

>input (226 residues)
MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVV
VFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVD
PEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTL
ILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7RTV5	1.000	1.000	8.164E-48	226	1.000	1.000	Q7RTV5.pdb.gz	PXL2C_HUMAN Peroxiredoxin-like 2C OS=Homo sapiens OX=9606 GN=PRXL2C PE=2 SV=1
2	AFDB:Q9ZUU2	0.639	0.586	3.913E-16	248	0.265	0.242	Q9ZUU2.pdb.gz	PXL2C_ARATH Thioredoxin-like protein AAED1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g37240 PE=1 SV=2
3	AFDB:A9CQL8	0.604	0.669	2.336E-12	202	0.186	0.208	A9CQL8.pdb.gz	PXL2B_PIG Prostamide/prostaglandin F synthase OS=Sus scrofa OX=9823 GN=PRXL2B PE=1 SV=1
4	AFDB:Q8TBF2	0.583	0.657	2.336E-12	198	0.208	0.237	Q8TBF2.pdb.gz	PXL2B_HUMAN Prostamide/prostaglandin F synthase OS=Homo sapiens OX=9606 GN=PRXL2B PE=1 SV=1
5	AFDB:Q8L5Y8	0.610	0.509	2.643E-12	275	0.226	0.185	Q8L5Y8.pdb.gz	Q8L5Y8_ARATH Thioredoxin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g65840 PE=1 SV=1
6	AFDB:D3ZVR7	0.609	0.675	4.069E-12	201	0.204	0.229	D3ZVR7.pdb.gz	PXL2B_RAT Prostamide/prostaglandin F synthase OS=Rattus norvegicus OX=10116 GN=Prxl2b PE=3 SV=1
7	AFDB:O53923	0.541	0.524	1.339E-9	234	0.128	0.124	O53923.pdb.gz	O53923_MYCTU Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1676 PE=1 SV=1
8	AFDB:Q9BRX8	0.573	0.566	3.109E-8	229	0.168	0.166	Q9BRX8.pdb.gz	PXL2A_HUMAN Peroxiredoxin-like 2A OS=Homo sapiens OX=9606 GN=PRXL2A PE=1 SV=3
9	AFDB:Q9CYH2	0.558	0.576	5.415E-8	218	0.173	0.179	Q9CYH2.pdb.gz	PXL2A_MOUSE Peroxiredoxin-like 2A OS=Mus musculus OX=10090 GN=Prxl2a PE=1 SV=2
10	AFDB:F4JBC9	0.527	0.548	7.676E-7	217	0.128	0.134	F4JBC9.pdb.gz	F4JBC9_ARATH thioredoxin-dependent peroxiredoxin OS=Arabidopsis thaliana OX=3702 GN=PRXQ PE=1 SV=1
11	PDB:2c0dB	0.485	0.609	3.358E-5	175	0.084	0.109	2c0dB.pdb.gz
12	PDB:5b6mF	0.499	0.505	4.298E-5	223	0.124	0.126	5b6mF.pdb.gz
13	PDB:4k1fA	0.481	0.541	7.486E-5	198	0.119	0.136	4k1fA.pdb.gz
14	PDB:3iosA	0.477	0.758	8.468E-5	134	0.088	0.149	3iosA.pdb.gz
15	PDB:3ztlB	0.515	0.623	9.007E-5	183	0.102	0.126	3ztlB.pdb.gz
16	PDB:4af2A	0.484	0.604	9.580E-5	175	0.106	0.137	4af2A.pdb.gz
17	PDB:2z9sA	0.484	0.547	1.019E-4	197	0.106	0.122	2z9sA.pdb.gz
18	PDB:1xvwB	0.517	0.707	1.304E-4	160	0.102	0.144	1xvwB.pdb.gz
19	PDB:2r37A	0.402	0.460	2.271E-4	191	0.084	0.099	2r37A.pdb.gz
20	PDB:2p31A	0.430	0.596	2.569E-4	155	0.106	0.155	2p31A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7RTV5	4.30e-168	463	226	1.000	1.000	PXL2C_HUMAN Peroxiredoxin-like 2C OS=Homo sapiens OX=9606 GN=PRXL2C PE=2 SV=1
2	Q9ZUU2	1.08e-24	99.8	248	0.265	0.242	PXL2C_ARATH Thioredoxin-like protein AAED1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g37240 PE=1 SV=2
3	Q9DB60	1.61e-14	71.6	201	0.226	0.254	PXL2B_MOUSE Prostamide/prostaglandin F synthase OS=Mus musculus OX=10090 GN=Prxl2b PE=1 SV=1
4	D3ZVR7	5.60e-14	70.1	201	0.226	0.254	PXL2B_RAT Prostamide/prostaglandin F synthase OS=Rattus norvegicus OX=10116 GN=Prxl2b PE=3 SV=1
5	Q8TBF2	1.91e-11	63.2	198	0.204	0.232	PXL2B_HUMAN Prostamide/prostaglandin F synthase OS=Homo sapiens OX=9606 GN=PRXL2B PE=1 SV=1
6	A9CQL8	2.31e-10	60.1	202	0.190	0.213	PXL2B_PIG Prostamide/prostaglandin F synthase OS=Sus scrofa OX=9823 GN=PRXL2B PE=1 SV=1
7	Q8L5Y8	1.85e-07	52.8	275	0.248	0.204	Q8L5Y8_ARATH Thioredoxin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g65840 PE=1 SV=1
8	Q9BRX8	0.030	37.0	229	0.195	0.192	PXL2A_HUMAN Peroxiredoxin-like 2A OS=Homo sapiens OX=9606 GN=PRXL2A PE=1 SV=3
9	A3EWL3	0.51	33.9	1105	0.058	0.012	REV1_ARATH DNA repair protein REV1 OS=Arabidopsis thaliana OX=3702 GN=REV1 PE=2 SV=1
10	Q00733	0.52	33.9	691	0.093	0.030	VP80_NPVAC Capsid-associated protein VP80 OS=Autographa californica nuclear polyhedrosis virus OX=46015 GN=VP80 PE=1 SV=1
11	Q9CYH2	0.85	32.3	218	0.181	0.188	PXL2A_MOUSE Peroxiredoxin-like 2A OS=Mus musculus OX=10090 GN=Prxl2a PE=1 SV=2
12	E3W735	2.5	31.6	450	0.084	0.042	E3W735_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pix-1 PE=1 SV=1
13	Q21430	2.6	31.6	646	0.084	0.029	Q21430_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pix-1 PE=1 SV=3
14	P35969	3.3	31.2	1333	0.102	0.017	VGFR1_MOUSE Vascular endothelial growth factor receptor 1 OS=Mus musculus OX=10090 GN=Flt1 PE=1 SV=1
15	Q23590	3.6	31.2	1390	0.075	0.012	BAZ2_CAEEL Bromodomain adjacent to zinc finger domain protein 2 OS=Caenorhabditis elegans OX=6239 GN=baz-2 PE=1 SV=4
16	E9Q8T7	3.8	31.2	4250	0.071	0.004	DYH1_MOUSE Dynein axonemal heavy chain 1 OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1
17	H3BUJ7	5.2	30.8	654	0.071	0.024	H3BUJ7_HUMAN E4F transcription factor 1 OS=Homo sapiens OX=9606 GN=E4F1 PE=1 SV=1
18	Q9STU3	5.2	30.8	795	0.133	0.038	MAG2_ARATH RINT1-like protein MAG2 OS=Arabidopsis thaliana OX=3702 GN=MAG2 PE=1 SV=1
19	Q66K89	6.0	30.4	784	0.071	0.020	E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens OX=9606 GN=E4F1 PE=1 SV=2
20	A0A8I6ALA5	6.6	30.4	1206	0.128	0.024	A0A8I6ALA5_RAT Peroxisomal ATPase PEX1 OS=Rattus norvegicus OX=10116 GN=Pex1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	0.013	26.8	AhpC/TSA family
2	PF13911 AhpC-TSA_2	5e-18	76.7	AhpC/TSA antioxidant enzyme
3	PF08299 Bac_DnaA_C	1.8e+02	13.6	Bacterial dnaA protein helix-turn-helix
4	PF05988 DUF899	84	14.1	Bacterial protein of unknown function (DUF899)
5	PF08534 Redoxin	0.028	25.6	Redoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364405	0.823	Zinc finger protein 367
2	9606.ENSP00000426941	0.772	28S ribosomal protein S27, mitochondrial
3	9606.ENSP00000437464	0.751	F-box/LRR-repeat protein 17
4	9606.ENSP00000217173	0.726	RING finger protein 37
5	9606.ENSP00000313921	0.641	Mitochondrial peptide methionine sulfoxide reductase
6	9606.ENSP00000352268	0.609	Arylacetamide deacetylase-like 3
7	9606.ENSP00000431808	0.591	Mth938 domain-containing protein
8	9606.ENSP00000393453	0.585	Histone-lysine N-methyltransferase SMYD1
9	9606.ENSP00000482445	0.577	Redox-regulatory protein FAM213A
10	9606.ENSP00000363043	0.574	Protein AAR2 homolog
11	9606.ENSP00000256257	0.572	RING finger protein 122
12	9606.ENSP00000385205	0.571	PRKCA-binding protein
13	9606.ENSP00000313158	0.569	Zinc finger protein 366
14	9606.ENSP00000365395	0.565	Arylacetamide deacetylase-like 4
15	9606.ENSP00000373696	0.561	E3 ubiquitin-protein ligase TRIP12
16	9606.ENSP00000236709	0.554	Alpha-1,4-N-acetylglucosaminyltransferase
17	9606.ENSP00000205214	0.540	Acyl-CoA synthetase family member 4
18	9606.ENSP00000261880	0.540	Alpha- and gamma-adaptin-binding protein p34
19	9606.ENSP00000348911	0.523	Arylacetamide deacetylase-like 2
20	9606.ENSP00000369436	0.518	Ankyrin repeat domain-containing protein 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0016491	0.995	oxidoreductase activity
GO:0004601	0.905	peroxidase activity
GO:0051920	0.845	peroxiredoxin activity
GO:0140824	0.686	thioredoxin-dependent peroxiredoxin activity
GO:0008379	0.432	thioredoxin peroxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.990	positive regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0080090	0.984	regulation of primary metabolic process
GO:0048522	0.984	positive regulation of cellular process
GO:0031323	0.982	regulation of cellular metabolic process
GO:0048583	0.976	regulation of response to stimulus
GO:0009894	0.975	regulation of catabolic process
GO:0043467	0.970	regulation of generation of precursor metabolites and energy
GO:1903578	0.970	regulation of ATP metabolic process
GO:0043470	0.969	regulation of carbohydrate catabolic process
GO:0023051	0.946	regulation of signaling
GO:0010646	0.946	regulation of cell communication
GO:0009893	0.938	positive regulation of metabolic process
GO:0009966	0.928	regulation of signal transduction
GO:0031325	0.925	positive regulation of cellular metabolic process
GO:0042325	0.923	regulation of phosphorylation
GO:0043408	0.923	regulation of MAPK cascade
GO:0062013	0.918	positive regulation of small molecule metabolic process
GO:0010562	0.906	positive regulation of phosphorus metabolic process
GO:0051173	0.901	positive regulation of nitrogen compound metabolic process
GO:0070372	0.894	regulation of ERK1 and ERK2 cascade
GO:0045913	0.893	positive regulation of carbohydrate metabolic process
GO:0006110	0.892	regulation of glycolytic process
GO:0045937	0.881	positive regulation of phosphate metabolic process
GO:0023056	0.872	positive regulation of signaling
GO:0010647	0.872	positive regulation of cell communication
GO:0045981	0.868	positive regulation of nucleotide metabolic process
GO:0009967	0.858	positive regulation of signal transduction
GO:1902533	0.769	positive regulation of intracellular signal transduction
GO:1900544	0.756	positive regulation of purine nucleotide metabolic process
GO:0009987	0.721	cellular process
GO:0071704	0.527	organic substance metabolic process
GO:0044237	0.523	cellular metabolic process
GO:0044238	0.506	primary metabolic process
GO:0043410	0.455	positive regulation of MAPK cascade
GO:1903580	0.451	positive regulation of ATP metabolic process
GO:0031329	0.426	regulation of cellular catabolic process
GO:0009896	0.417	positive regulation of catabolic process
GO:0031331	0.404	positive regulation of cellular catabolic process
GO:0042327	0.400	positive regulation of phosphorylation
GO:0070374	0.392	positive regulation of ERK1 and ERK2 cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.986	organelle
GO:0043227	0.947	membrane-bounded organelle
GO:0043229	0.923	intracellular organelle
GO:0005829	0.920	cytosol
GO:0043231	0.841	intracellular membrane-bounded organelle
GO:0031982	0.373	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.995	Oxidoreductases.
EC:1.11.1.-	0.905	Peroxidases.
RHEA:10008	0.845	[protein]-dithiol + a hydroperoxide = [protein]-disulfide + an alcohol + H2O
RHEA:62620	0.686	[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O
EC:1.11.1.24	0.686	thioredoxin-dependent peroxiredoxin.
RHEA:63528	0.432	[thioredoxin]-dithiol + H2O2 = [thioredoxin]-disulfide + 2 H2O

[back to server]