StarFunc result for job id Q7RTW8

User Input

>input (1153 residues)
MSQEPTTYSLFLFLFLSHGVSSYTVPNSRQDLHPLLQNMAEEIIDGSYLNALLDLIQFQS
SHVWTDDLSHRVLAYLNSRNVAFTIPSLQAAVENHLEQRLHQPQKLLEDLRKTDAQQFRT
AMKCLLEDKKDGLDLKDIIIDLGEIRERALQSPGVNRSLFLITLERCFQMLNSLECVEIL
GKVLRGSSGSFLQPDITERLPRDLREDAFKNLSAVFKDLYDKTSAHSQRALYSWMTGILQ
TSSNATDDSASWVSAEHLWVLGRYMVHLSFEEITKISPIEIGLFISYDNATKQLDMVYDI
TPELAQAFLERISSSNFNMRNTSTIHRQAHELWALEPFPKMLGLLVCFYNDLELLDATVA
QVLLYQMIKCSHLRGFQAGVQKLKAELLDIAMENQTLNETLGSLSDAVVGLTYSQLESLS
PEAVHGAISTLNQVSGWAKSQVIILSAKYLAHEKVLSFYNVSQMGALLAGVSTQAFCSMK
RKDISQVLRSAVSQYVSDLSPAQQQGILSKMVQAEDTAPGIVEIQGAFFKEVSLFDLRRQ
PGFNSTVLKDKELGRSQALFLYELLLKTTRRPEELLSAGQLVKGVTCSHIDAMSTDFFLA
HFQDFQNNFALLSPYQVNCLAWKYWEVSRLSMPPFLLAALPARYLASVPASQCVPFLISL
GKSWLDSLVLDSHKKTSVLRKVQQCLDDSIADEYTVDIMGNLLCHLPAAIIDRGISPRAW
ATALHGLRDCPDLNPEQKAAVRLKLLGQYGLPQHWTAETTKDLGPFLVLFSGDELSSIAT
KFPEILLQAASKMARTLPTKEFLWAVFQSVRNSSDKIPSYDPMPGCHGVVAPSSDDIFKL
AEANACWALEDLRCMEEDTFIRTVELLGAVQGFSRPQLMTLKEKAIQVWDMPSYWREHHI
VSLGRIALALNESELEQLDLSSIDTVASLSWQTEWTPGQAESILQGYLDDSGYSIQDLKS
FHLVGLGATLCAINITEIPLIKISEFRVVVARIGTLLCSTHVLAEFKRKAEVVFGDPTEW
TSSVLQELGTIAAGLTKAELRMLDKDLMPYFQPSAIKCLPDEIFKELSAEQIASLGPENA
AAVTHAQRRRLSPLQLQSLQQALDGAKTHSWQDAPASAGPTRTSSSRSPAGALQSWGLWL
GCPLLVLMAKLLW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7RTW8	1.000	1.000	0.000	1153	1.000	1.000	Q7RTW8.pdb.gz	OTOAN_HUMAN Otoancorin OS=Homo sapiens OX=9606 GN=OTOA PE=1 SV=1
2	AFDB:Q8K561	0.951	0.964	0.000	1137	0.762	0.773	Q8K561.pdb.gz	OTOAN_MOUSE Otoancorin OS=Mus musculus OX=10090 GN=Otoa PE=2 SV=1
3	AFDB:Q8VIM6	0.578	0.387	6.640E-29	1809	0.194	0.124	Q8VIM6.pdb.gz	STRC_MOUSE Stereocilin OS=Mus musculus OX=10090 GN=Strc PE=2 SV=2
4	AFDB:A1L378	0.507	0.570	1.041E-23	1002	0.190	0.219	A1L378.pdb.gz	A1L378_HUMAN STRC protein OS=Homo sapiens OX=9606 GN=STRC PE=1 SV=1
5	AFDB:Q61468	0.226	0.354	9.673E-13	625	0.101	0.187	Q61468.pdb.gz	MSLN_MOUSE Mesothelin OS=Mus musculus OX=10090 GN=Msln PE=1 SV=1
6	AFDB:Q13421	0.282	0.471	5.095E-12	630	0.093	0.170	Q13421.pdb.gz	MSLN_HUMAN Mesothelin OS=Homo sapiens OX=9606 GN=MSLN PE=1 SV=2
7	AFDB:P29539	0.097	0.068	3.059E-7	1916	0.137	0.082	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
8	AFDB:A0A120KVR5	0.135	0.108	7.700E-7	1642	0.154	0.108	A0A120KVR5.pdb.gz	MPSS2_TRYBB Mitochondrial 3' processome subunit 2 OS=Trypanosoma brucei brucei OX=5702 GN=MPSS2 PE=1 SV=1
9	AFDB:Q38F80	0.116	0.110	7.989E-7	1345	0.117	0.100	Q38F80.pdb.gz	Q38F80_TRYB2 Mitochondrial RNA binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3220 PE=4 SV=1
10	AFDB:Q585T1	0.148	0.176	1.035E-6	872	0.125	0.165	Q585T1.pdb.gz	Q585T1_TRYB2 Mitochondrial RNA binding complex 1 subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=27H14.10 PE=4 SV=1
11	PDB:7kzvV	0.102	0.102	7.716E-6	1155	0.126	0.126	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
12	PDB:6xu2A	0.125	0.128	1.872E-5	1091	0.114	0.121	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
13	PDB:3s4wB	0.108	0.108	2.336E-5	1146	0.122	0.123	3s4wB.pdb.gz
14	PDB:7nfeA	0.131	0.059	2.609E-5	3585	0.134	0.043	7nfeA.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
15	PDB:7vf2A	0.102	0.100	4.540E-5	1196	0.139	0.134	7vf2A.pdb.gz
16	PDB:7mqaLM	0.109	0.073	7.613E-5	2041	0.138	0.078	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:6vaeA	0.108	0.105	7.899E-5	1198	0.120	0.115	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
18	PDB:7sx3D	0.092	0.080	1.023E-4	1418	0.128	0.104	7sx3D.pdb.gz	Structural architecture of the human NALCN channelosome.
19	PDB:5hb4B	0.118	0.106	1.101E-4	1388	0.144	0.120	5hb4B.pdb.gz
20	PDB:7mq8LM	0.116	0.081	1.230E-4	2005	0.137	0.079	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7RTW8	0.0	2367	1153	1.000	1.000	OTOAN_HUMAN Otoancorin OS=Homo sapiens OX=9606 GN=OTOA PE=1 SV=1
2	Q8K561	0.0	1741	1137	0.753	0.763	OTOAN_MOUSE Otoancorin OS=Mus musculus OX=10090 GN=Otoa PE=2 SV=1
3	A1L378	1.04e-21	104	1002	0.082	0.095	A1L378_HUMAN STRC protein OS=Homo sapiens OX=9606 GN=STRC PE=1 SV=1
4	Q8VIM6	1.36e-18	94.7	1809	0.070	0.045	STRC_MOUSE Stereocilin OS=Mus musculus OX=10090 GN=Strc PE=2 SV=2
5	Q61468	0.001	45.4	625	0.065	0.120	MSLN_MOUSE Mesothelin OS=Mus musculus OX=10090 GN=Msln PE=1 SV=1
6	A0A8I5ZW41	0.61	37.0	1465	0.016	0.012	A0A8I5ZW41_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=3 SV=1
7	A0A8I6AFL3	0.62	37.0	1455	0.016	0.012	A0A8I6AFL3_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=3 SV=1
8	F1LXJ9	0.64	36.6	1454	0.016	0.012	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
9	Q99M80	0.64	36.6	1454	0.016	0.012	PTPRT_MOUSE Receptor-type tyrosine-protein phosphatase T OS=Mus musculus OX=10090 GN=Ptprt PE=1 SV=2
10	O14522	0.66	36.6	1441	0.016	0.012	PTPRT_HUMAN Receptor-type tyrosine-protein phosphatase T OS=Homo sapiens OX=9606 GN=PTPRT PE=1 SV=6
11	F4JS93	1.7	35.0	347	0.012	0.040	F4JS93_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At4g13150 PE=1 SV=1
12	Q68EI5	2.6	34.7	826	0.018	0.025	Q68EI5_DANRE Band 4.1-like protein 3 OS=Danio rerio OX=7955 GN=zgc:92004 PE=1 SV=1
13	Q09866	3.3	34.3	905	0.028	0.035	YAG1_SCHPO Uncharacterized WD repeat-containing protein C12G12.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12G12.01c PE=1 SV=2
14	Q980K5	3.3	34.3	600	0.020	0.038	Q980K5_SACS2 RNase L inhibitor OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=SSO0287 PE=1 SV=1
15	O60112	3.8	33.9	459	0.014	0.035	YG63_SCHPO Uncharacterized Rab geranylgeranyltransferase C15C4.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC15C4.03 PE=3 SV=1
16	Q9ERA7	6.1	33.5	625	0.060	0.110	MSLN_RAT Mesothelin OS=Rattus norvegicus OX=10116 GN=Msln PE=2 SV=2
17	P12576	6.4	33.5	2183	0.021	0.011	L_MEASE RNA-directed RNA polymerase L OS=Measles virus (strain Edmonston) OX=11235 GN=L PE=2 SV=1
18	E7EPS8	7.1	33.5	1390	0.014	0.012	E7EPS8_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
19	P28827	7.3	33.1	1452	0.014	0.011	PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
20	P28828	7.6	33.1	1452	0.014	0.011	PTPRM_MOUSE Receptor-type tyrosine-protein phosphatase mu OS=Mus musculus OX=10090 GN=Ptprm PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17940 TetR_C_31	1.5e+02	13.9	Tetracyclin repressor-like, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000013426

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000005362	0.831	Uncharacterized protein
2	9598.ENSPTRP00000017727	0.831	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
3	9598.ENSPTRP00000027040	0.763	Uncharacterized protein
4	9598.ENSPTRP00000028170	0.759	PR domain containing 5
5	9598.ENSPTRP00000055657	0.702	Uncharacterized protein
6	9598.ENSPTRP00000006405	0.694	Zona pellucida glycoprotein 1 (sperm receptor)
7	9598.ENSPTRP00000009161	0.693	Uncharacterized protein
8	9598.ENSPTRP00000035093	0.693	Uncharacterized protein
9	9598.ENSPTRP00000005190	0.692	Tectorin beta
10	9598.ENSPTRP00000017170	0.678	Uncharacterized protein
11	9598.ENSPTRP00000007528	0.671	Tectorin alpha
12	9598.ENSPTRP00000008931	0.671	Uncharacterized protein
13	9598.ENSPTRP00000027337	0.668	Uncharacterized protein
14	9598.ENSPTRP00000023992	0.644	Uncharacterized protein
15	9598.ENSPTRP00000007428	0.634	Uncharacterized protein
16	9598.ENSPTRP00000028449	0.571	Metalloendopeptidase
17	9598.ENSPTRP00000033528	0.569	Pendrin
18	9598.ENSPTRP00000008873	0.567	Tetraspanin 8
19	9598.ENSPTRP00000044726	0.559	Uncharacterized protein
20	9598.ENSPTRP00000057043	0.549	Carcinoembryonic antigen-related cell adhesion molecule 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007605	0.987	sensory perception of sound
GO:0009987	0.982	cellular process
GO:0019226	0.751	transmission of nerve impulse
GO:0007155	0.727	cell adhesion
GO:0031589	0.643	cell-substrate adhesion
GO:0007160	0.634	cell-matrix adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.972	extracellular region
GO:0043226	0.763	organelle
GO:0005622	0.747	intracellular anatomical structure
GO:0043227	0.740	membrane-bounded organelle
GO:0043229	0.732	intracellular organelle
GO:0005737	0.685	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]