StarFunc result for job id Q7RTY1

User Input

>input (509 residues)
MELKKSPDGGWGWVIVFVSFLTQFLCYGSPLAVGVLYIEWLDAFGEGKGKTAWVGSLASG
VGLLASPVCSLCVSSFGARPVTIFSGFMVAGGLMLSSFAPNIYFLFFSYGIVVGLGCGLL
YTATVTITCQYFDDRRGLALGLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALN
ILACGSLMRPLQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENINILDKSYSSEEKCRI
TLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCKQLAKRKWQLYKNYCGETVAL
FKNKVFSALFIAILLFDIGGFPPSLLMEDVARSSNVKEEEFIMPLISIIGIMTAVGKLLL
GILADFKWINTLYLYVATLIIMGLALCAIPFAKSYVTLALLSGILGFLTGNWSIFPYVTT
KTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTQTYDIAFYFSGFCVLLGGFILLL
AALPSWDTCNKQLPKPAPTTFLYKVASNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7RTY1	1.000	1.000	1.912E-63	509	1.000	1.000	Q7RTY1.pdb.gz	MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens OX=9606 GN=SLC16A9 PE=1 SV=1
2	AFDB:O95907	0.743	0.750	6.898E-23	504	0.251	0.254	O95907.pdb.gz	MOT3_HUMAN Monocarboxylate transporter 3 OS=Homo sapiens OX=9606 GN=SLC16A8 PE=1 SV=1
3	AFDB:O15374	0.650	0.676	1.799E-22	487	0.250	0.261	O15374.pdb.gz	MOT5_HUMAN Monocarboxylate transporter 5 OS=Homo sapiens OX=9606 GN=SLC16A4 PE=1 SV=1
4	AFDB:A0A024RBB2	0.733	0.780	1.872E-22	478	0.248	0.264	A0A024RBB2.pdb.gz
5	AFDB:Q6ZSM3	0.705	0.696	2.286E-22	516	0.236	0.233	Q6ZSM3.pdb.gz	MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens OX=9606 GN=SLC16A12 PE=1 SV=3
6	AFDB:D4A734	0.708	0.739	6.722E-22	486	0.242	0.253	D4A734.pdb.gz	MOT12_RAT Monocarboxylate transporter 12 OS=Rattus norvegicus OX=10116 GN=Slc16a12 PE=1 SV=1
7	AFDB:O35910	0.715	0.771	6.722E-22	471	0.234	0.253	O35910.pdb.gz	MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus OX=10116 GN=Slc16a3 PE=1 SV=1
8	AFDB:A0A024R0H1	0.728	0.741	1.130E-21	500	0.238	0.242	A0A024R0H1.pdb.gz
9	AFDB:A0A0R4IHG0	0.703	0.722	1.224E-21	495	0.222	0.228	A0A0R4IHG0.pdb.gz
10	AFDB:P53988	0.742	0.779	1.618E-21	484	0.234	0.246	P53988.pdb.gz	MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus OX=10036 GN=SLC16A7 PE=1 SV=1
11	PDB:7yr5A	0.708	0.928	1.556E-15	385	0.206	0.273	7yr5A.pdb.gz
12	PDB:7bp3A	0.652	0.831	1.089E-12	394	0.196	0.254	7bp3A.pdb.gz
13	PDB:5oxpA	0.564	0.613	7.929E-10	462	0.132	0.145	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
14	PDB:6kkkA	0.620	0.808	1.936E-8	381	0.114	0.152	6kkkA.pdb.gz
15	PDB:6thaA	0.561	0.628	2.665E-8	448	0.128	0.145	6thaA.pdb.gz
16	PDB:6fmrA	0.610	0.648	2.774E-8	475	0.139	0.149	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.
17	PDB:4q65A	0.530	0.604	3.127E-8	437	0.149	0.174	4q65A.pdb.gz
18	PDB:4ja4A	0.571	0.649	1.317E-7	442	0.128	0.147	4ja4A.pdb.gz
19	PDB:6gs1A	0.583	0.624	2.597E-7	472	0.139	0.150	6gs1A.pdb.gz
20	PDB:7wsmA	0.567	0.614	2.703E-7	464	0.122	0.134	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7RTY1	0.0	1026	509	1.000	1.000	MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens OX=9606 GN=SLC16A9 PE=1 SV=1
2	O15374	3.07e-50	181	487	0.271	0.283	MOT5_HUMAN Monocarboxylate transporter 5 OS=Homo sapiens OX=9606 GN=SLC16A4 PE=1 SV=1
3	Q8BGC3	2.36e-48	176	486	0.251	0.263	MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus OX=10090 GN=Slc16a12 PE=1 SV=1
4	D4A734	2.25e-46	170	486	0.255	0.267	MOT12_RAT Monocarboxylate transporter 12 OS=Rattus norvegicus OX=10116 GN=Slc16a12 PE=1 SV=1
5	Q6ZSM3	3.55e-46	170	516	0.255	0.252	MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens OX=9606 GN=SLC16A12 PE=1 SV=3
6	O15403	5.84e-45	167	523	0.240	0.233	MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens OX=9606 GN=SLC16A6 PE=1 SV=2
7	Q8T043	1.24e-36	146	894	0.151	0.086	Q8T043_DROME Chaski, isoform A OS=Drosophila melanogaster OX=7227 GN=chk PE=2 SV=1
8	H6WYF6	1.90e-35	140	495	0.250	0.257	H6WYF6_DANRE Solute carrier family 16 member 6a OS=Danio rerio OX=7955 GN=Slc16a6a PE=1 SV=1
9	Q03064	1.87e-34	137	494	0.232	0.239	MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus OX=10030 GN=SLC16A1 PE=1 SV=1
10	O60669	2.26e-34	137	478	0.244	0.259	MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens OX=9606 GN=SLC16A7 PE=1 SV=2
11	F8W0N3	5.53e-34	135	435	0.244	0.285	F8W0N3_HUMAN Solute carrier family 16 member 7 (Fragment) OS=Homo sapiens OX=9606 GN=SLC16A7 PE=1 SV=1
12	Q7JWI7	9.59e-33	134	658	0.153	0.119	Q7JWI7_DROME Hermes, isoform A OS=Drosophila melanogaster OX=7227 GN=hrm PE=1 SV=1
13	P53987	5.16e-32	130	494	0.222	0.229	MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc16a1 PE=1 SV=1
14	Q5T8R5	9.26e-31	126	456	0.226	0.252	Q5T8R5_HUMAN Monocarboxylate transporter 1 (Fragment) OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=1
15	P53986	9.70e-31	127	493	0.216	0.223	MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus OX=10090 GN=Slc16a1 PE=1 SV=1
16	J3QSC3	1.13e-30	122	291	0.147	0.258	J3QSC3_HUMAN Monocarboxylate transporter 4 (Fragment) OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1
17	P53985	1.24e-30	126	500	0.226	0.230	MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3
18	P57787	1.60e-30	125	470	0.151	0.164	MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus OX=10090 GN=Slc16a3 PE=1 SV=1
19	O35910	2.65e-30	125	471	0.153	0.166	MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus OX=10116 GN=Slc16a3 PE=1 SV=1
20	J3QRA0	6.03e-30	119	223	0.141	0.323	J3QRA0_HUMAN Monocarboxylate transporter 4 (Fragment) OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	3.8e-30	116.6	Major Facilitator Superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378757

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331983	0.828	F-actin-uncapping protein LRRC16A
2	9606.ENSP00000264784	0.764	Solute carrier family 2, facilitated glucose transporter member 9
3	9606.ENSP00000301891	0.753	Solute carrier family 22 member 11
4	9606.ENSP00000244527	0.741	Sodium-dependent phosphate transport protein 1
5	9606.ENSP00000394485	0.740	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
6	9606.ENSP00000366797	0.713	Solute carrier family 22 member 12
7	9606.ENSP00000380250	0.710	Sodium-dependent phosphate transport protein 4
8	9606.ENSP00000367137	0.680	Probable small intestine urate exporter
9	9606.ENSP00000302289	0.643	Embigin
10	9606.ENSP00000230256	0.641	Unc-93 homolog A
11	9606.ENSP00000385028	0.601	Solute carrier family 22 member 23
12	9606.ENSP00000355893	0.600	Zinc transporter 10
13	9606.ENSP00000266980	0.596	Zinc transporter ZIP5
14	9606.ENSP00000406546	0.594	Solute carrier family 23 member 3
15	9606.ENSP00000237612	0.566	ATP-binding cassette sub-family G member 2
16	9606.ENSP00000369270	0.566	Ras-responsive element-binding protein 1
17	9606.ENSP00000339186	0.562	GRB2-related adapter protein 2
18	9606.ENSP00000344648	0.560	Glucose-6-phosphate exchanger SLC37A1
19	9606.ENSP00000261024	0.554	Solute carrier family 40 member 1
20	9606.ENSP00000335247	0.554	START domain-containing protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046943	1.000	carboxylic acid transmembrane transporter activity
GO:0072349	0.998	modified amino acid transmembrane transporter activity
GO:0015101	0.998	organic cation transmembrane transporter activity
GO:0005515	0.996	protein binding
GO:0015226	0.992	carnitine transmembrane transporter activity
GO:0022804	0.783	active transmembrane transporter activity
GO:1901702	0.736	salt transmembrane transporter activity
GO:0015291	0.679	secondary active transmembrane transporter activity
GO:0015318	0.642	inorganic molecular entity transmembrane transporter activity
GO:0008028	0.352	monocarboxylic acid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015718	0.996	monocarboxylic acid transport
GO:0055085	0.988	transmembrane transport
GO:0071704	0.987	organic substance metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0071705	0.958	nitrogen compound transport
GO:0072337	0.949	modified amino acid transport
GO:1901564	0.905	organonitrogen compound metabolic process
GO:0044237	0.886	cellular metabolic process
GO:0034641	0.732	cellular nitrogen compound metabolic process
GO:1901360	0.719	organic cyclic compound metabolic process
GO:0046483	0.709	heterocycle metabolic process
GO:1903825	0.641	organic acid transmembrane transport
GO:0006725	0.542	cellular aromatic compound metabolic process
GO:0044281	0.508	small molecule metabolic process
GO:0015695	0.489	organic cation transport
GO:1905039	0.471	carboxylic acid transmembrane transport
GO:0072521	0.419	purine-containing compound metabolic process
GO:0015838	0.368	amino-acid betaine transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.732	organelle
GO:0043227	0.715	membrane-bounded organelle
GO:0005622	0.693	intracellular anatomical structure
GO:0043229	0.419	intracellular organelle
GO:0043231	0.346	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]