StarFunc result for job id Q7RTY7

User Input

>input (1134 residues)
MGLLASAGLLLLLVIGHPRSLGLKCGIRMVNMKSKEPAVGSRFFSRISSWRNSTVTGHPW
QVSLKSDEHHFCGGSLIQEDRVVTAAHCLDSLSEKQLKNITVTSGEYSLFQKDKQEQNIP
VSKIITHPEYNSREYMSPDIALLYLKHKVKFGNAVQPICLPDSDDKVEPGILCLSSGWGK
ISKTSEYSNVLQEMELPIMDDRACNTVLKSMNLPPLGRTMLCAGFPDWGMDACQGDSGGP
LVCRRGGGIWILAGITSWVAGCAGGSVPVRNNHVKASLGIFSKVSELMDFITQNLFTGLD
RGQPLSKVGSRYITKALSSVQEVNGSQRGKGILDMEKQVGCDHDYVSLRSSSGVLFNQRS
LMEDDGKQNKRVCGKILPSPLLAETSEAMVPFVSDTEDSGSGFELTVTAVQKSEAGSGCG
SLAILVEEGTNHSAKYPDLYPSNIRCHWFICAPEKHIIKLTFEDFAVKFSPNCIYDAVVI
YGDSEEKHKLAKLCGMLTITSIFSSSNMTVIYFKSDGKNRLQGFKARFTILPSESLNKFE
PKLPPQNNPVSTVKAILHDVCGIPPFSPQWLSRRIAGGEEACPHCWPWQVGLRFLGDYQC
GGAIINPVWILTAAHCVQLKNNPLSWTIIAGDHDRNLKESTEQVRRAKHIIVHEDFNTLS
YDSDIALIQLSSPLEYNSVVRPVCLPHSAEPLFSSEICAVTGWGSISADGGLASRLQQIQ
VHVLEREVCEHTYYSAHPGGITEKMICAGFAASGEKDFCQGDSGGPLVCRHENGPFVLYG
IVSWGAGCVQPWKPGVFARVMIFLDWIQSKINGPASLQTNNKCKTLKQQLPPPTPSPDSA
SWPGCCSEAELEKPRGFFPTPRYLLDYRGRLECSWVLRVSPSSMAKFTIEYLSLLGSPVC
QDSVLIIYEERHSKRKTAGGLHGRRLYSMTFMSPGPLVRVTFHALVRGAFGISYIDLKVL
GPKDSKITRLSQSSNREHLVPCEDVLLTKPEGIMQIPRNSHRTTMGCQWRLVAPLNHIIQ
LNIINFPMKPTTFVCHGHLRVYEGFGPGKKLIASFAGTLAMILTKDILKREKLNFINTYI
MHIWENSVYDNVRSVGKRKQKKFASNLSYSMEAEKSRIQVPADLVPAKGSLSGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7M761	0.226	0.412	2.598E-40	609	0.162	0.302	Q7M761.pdb.gz	OVCH2_MOUSE Ovochymase-2 OS=Mus musculus OX=10090 GN=Ovch2 PE=2 SV=1
2	AFDB:Q7RTZ1	0.230	0.447	1.652E-39	564	0.168	0.339	Q7RTZ1.pdb.gz	OVCH2_HUMAN Ovochymase-2 OS=Homo sapiens OX=9606 GN=OVCH2 PE=3 SV=2
3	AFDB:Q5K4E3	0.211	0.278	2.018E-34	855	0.162	0.215	Q5K4E3.pdb.gz	POLS2_HUMAN Polyserase-2 OS=Homo sapiens OX=9606 GN=PRSS36 PE=1 SV=2
4	AFDB:Q5K2P8	0.210	0.279	7.984E-34	849	0.164	0.219	Q5K2P8.pdb.gz	POLS2_MOUSE Polyserase-2 OS=Mus musculus OX=10090 GN=Prss36 PE=2 SV=1
5	AFDB:Q2L4Q9	0.191	0.379	6.399E-31	553	0.141	0.289	Q2L4Q9.pdb.gz	PRS53_HUMAN Serine protease 53 OS=Homo sapiens OX=9606 GN=PRSS53 PE=1 SV=1
6	AFDB:Q9DBI0	0.207	0.288	3.044E-28	811	0.113	0.158	Q9DBI0.pdb.gz	TMPS6_MOUSE Transmembrane protease serine 6 OS=Mus musculus OX=10090 GN=Tmprss6 PE=1 SV=4
7	AFDB:Q8IU80	0.208	0.289	6.818E-28	811	0.109	0.153	Q8IU80.pdb.gz	TMPS6_HUMAN Transmembrane protease serine 6 OS=Homo sapiens OX=9606 GN=TMPRSS6 PE=1 SV=3
8	AFDB:J3KR90	0.209	0.236	2.151E-22	1005	0.082	0.093	J3KR90.pdb.gz	J3KR90_HUMAN Corin, serine peptidase OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=1
9	AFDB:Q9Y5Q5	0.210	0.228	7.738E-22	1042	0.080	0.087	Q9Y5Q5.pdb.gz	CORIN_HUMAN Atrial natriuretic peptide-converting enzyme OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=2
10	AFDB:Q9ES87	0.212	0.677	2.655E-21	342	0.080	0.266	Q9ES87.pdb.gz	PRSS8_RAT Prostasin OS=Rattus norvegicus OX=10116 GN=Prss8 PE=2 SV=3
11	PDB:1cgiE	0.206	0.920	9.444E-21	245	0.083	0.384	1cgiE.pdb.gz
12	PDB:4bnrA	0.196	0.894	1.591E-20	237	0.079	0.380	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
13	PDB:6qfgA	0.189	0.920	4.736E-20	223	0.076	0.386	6qfgA.pdb.gz	Evaluation of a crystallographic surrogate for kallikrein 5 in the discovery of novel inhibitors for Netherton syndrome.
14	PDB:2a31A	0.189	0.926	1.787E-19	223	0.087	0.444	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
15	PDB:1fiwA	0.200	0.840	3.156E-19	260	0.076	0.331	1fiwA.pdb.gz	Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
16	PDB:6i44A	0.197	0.370	3.816E-19	594	0.093	0.177	6i44A.pdb.gz	Plasma kallikrein structure reveals apple domain disc rotated conformation compared to factor XI.
17	PDB:1amhA	0.190	0.932	4.195E-19	223	0.085	0.430	1amhA.pdb.gz	The three-dimensional structure of Asp189Ser trypsin provides evidence for an inherent structural plasticity of the protease.
18	PDB:1a0lA	0.197	0.873	7.412E-19	244	0.086	0.398	1a0lA.pdb.gz	Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
19	PDB:4a5tS	0.205	0.300	7.772E-19	767	0.086	0.128	4a5tS.pdb.gz
20	PDB:2a7jA	0.196	0.886	1.136E-18	240	0.075	0.354	2a7jA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7RTZ1	2.81e-93	311	564	0.171	0.344	OVCH2_HUMAN Ovochymase-2 OS=Homo sapiens OX=9606 GN=OVCH2 PE=3 SV=2
2	A0A182C2Z2	6.07e-89	317	1575	0.228	0.164	OVCH_HALRO Ovochymase OS=Halocynthia roretzi OX=7729 GN=OVCH PE=1 SV=1
3	Q7M761	7.25e-83	284	609	0.166	0.309	OVCH2_MOUSE Ovochymase-2 OS=Mus musculus OX=10090 GN=Ovch2 PE=2 SV=1
4	Q8VHJ4	2.39e-52	192	417	0.092	0.249	TM11D_RAT Transmembrane protease serine 11D OS=Rattus norvegicus OX=10116 GN=Tmprss11d PE=2 SV=1
5	C9J5Y1	3.15e-51	189	452	0.087	0.219	C9J5Y1_HUMAN Transmembrane serine protease 2 OS=Homo sapiens OX=9606 GN=TMPRSS2 PE=1 SV=2
6	Q5QSK2	5.71e-51	187	417	0.086	0.233	TM11G_RAT Transmembrane protease serine 11G OS=Rattus norvegicus OX=10116 GN=Tmprss11g PE=2 SV=1
7	Q1JRP2	8.57e-51	187	431	0.095	0.251	TM11C_MOUSE Transmembrane protease serine 11C OS=Mus musculus OX=10090 GN=Tmprss11c PE=1 SV=1
8	O15393	1.32e-50	189	492	0.087	0.201	TMPS2_HUMAN Transmembrane protease serine 2 OS=Homo sapiens OX=9606 GN=TMPRSS2 PE=1 SV=3
9	C9JKZ3	1.39e-50	189	489	0.087	0.202	C9JKZ3_HUMAN Transmembrane protease serine 2 (Fragment) OS=Homo sapiens OX=9606 GN=TMPRSS2 PE=1 SV=1
10	Q9UL52	2.45e-50	186	423	0.093	0.248	TM11E_HUMAN Transmembrane protease serine 11E OS=Homo sapiens OX=9606 GN=TMPRSS11E PE=1 SV=2
11	Q9I7V4	1.29e-49	182	364	0.081	0.253	Q9I7V4_DROME MIP24941p OS=Drosophila melanogaster OX=7227 GN=SP22 PE=2 SV=1
12	Q8VHK8	1.63e-49	183	417	0.090	0.245	TM11D_MOUSE Transmembrane protease serine 11D OS=Mus musculus OX=10090 GN=Tmprss11d PE=1 SV=2
13	Q5S248	1.65e-49	184	423	0.088	0.236	TM11E_MOUSE Transmembrane protease serine 11E OS=Mus musculus OX=10090 GN=Tmprss11e PE=1 SV=2
14	O60235	4.04e-49	182	418	0.084	0.227	TM11D_HUMAN Transmembrane protease serine 11D OS=Homo sapiens OX=9606 GN=TMPRSS11D PE=1 SV=1
15	P0CW18	8.16e-49	186	603	0.093	0.174	PRS56_HUMAN Serine protease 56 OS=Homo sapiens OX=9606 GN=PRSS56 PE=1 SV=1
16	Q86T26	1.34e-48	181	416	0.078	0.214	TM11B_HUMAN Transmembrane protease serine 11B OS=Homo sapiens OX=9606 GN=TMPRSS11B PE=2 SV=3
17	Q9Y5Y6	2.05e-48	189	855	0.093	0.123	ST14_HUMAN Suppressor of tumorigenicity 14 protein OS=Homo sapiens OX=9606 GN=ST14 PE=1 SV=2
18	Q9DBI0	8.65e-48	186	811	0.088	0.123	TMPS6_MOUSE Transmembrane protease serine 6 OS=Mus musculus OX=10090 GN=Tmprss6 PE=1 SV=4
19	P29293	1.07e-47	179	437	0.088	0.229	ACRO_RAT Acrosin OS=Rattus norvegicus OX=10116 GN=Acr PE=2 SV=2
20	Q8K1T0	1.28e-47	179	453	0.085	0.212	TMPS3_MOUSE Transmembrane protease serine 3 OS=Mus musculus OX=10090 GN=Tmprss3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	2.9e-40	148.4	CUB domain
2	PF09342 DUF1986	7.5e-14	63.5	Domain of unknown function (DUF1986)
3	PF00089 Trypsin	1.4e-126	432.3	Trypsin
4	PF13365 Trypsin_2	8.2e-08	44.8	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417222	0.650	M14 carboxypeptidases
2	9606.ENSP00000391209	0.596	Cytochrome b561 family member D2
3	9606.ENSP00000482374	0.556	Proline-rich protein 36
4	9606.ENSP00000264151	0.540	Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial
5	9606.ENSP00000368876	0.517	TOG array regulator of axonemal microtubules protein 2
6	9606.ENSP00000273158	0.507	Solute carrier family 25 member 38

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004175	1.000	endopeptidase activity
GO:0008236	1.000	serine-type peptidase activity
GO:0005515	0.995	protein binding
GO:0004252	0.949	serine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.942	organic substance metabolic process
GO:0006807	0.879	nitrogen compound metabolic process
GO:0043170	0.705	macromolecule metabolic process
GO:1901564	0.657	organonitrogen compound metabolic process
GO:0044238	0.636	primary metabolic process
GO:0019538	0.601	protein metabolic process
GO:0000003	0.501	reproduction
GO:0006508	0.483	proteolysis
GO:0009987	0.445	cellular process
GO:0009566	0.326	fertilization
GO:0065007	0.303	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005615	0.935	extracellular space
GO:0043226	0.927	organelle
GO:0005737	0.809	cytoplasm
GO:0043231	0.740	intracellular membrane-bounded organelle
GO:0016020	0.517	membrane
GO:0031982	0.303	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.949	Serine endopeptidases.

[back to server]