StarFunc result for job id Q7Z2K6

User Input

>input (904 residues)
MEWGSESAAVRRHRVGVERREGAAAAPPPEREARAQEPLVDGCSGGGRTRKRSPGGSGGA
SRGAGTGLSEVRAALGLALYLIALRTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHIT
SIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYY
DNITNVVVKLEPRDGAQHAVLANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEALH
HAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQ
AYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTA
DRILTDSIQRAGDNILAVLKHLATSDMLAAASKYRHGNMVFFDVLGLFVIAYPSRIGSII
NYMVVMGVVLYLGKKFLQPKHKTGNYKKDFLCGLGITLISWFTSLVTVLIIAVFISLIGQ
SLSWYNHFYVSVCLYGTATVAKIILIHTLAKRFYYMNASAQYLGEVFFDISLFVHCCFLV
TLTYQGLCSAFISAVWVAFPLLTKLCVHKDFKQHGAQGKFIAFYLLGMFIPYLYALYLIW
AVFEMFTPILGRSGSEIPPDVVLASILAGCTMILSSYFINFIYLAKSTKKTMLTLTLVCA
ITFLLVCSGTFFPYSSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGIS
HITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPHFRLISK
EQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPVTSKGGDYFVFYSHGLQA
SAWQFWIEVQVSEEHPEGMVTVAIAAHYLSGEDKRSPQLDALKEKFPDWTFPSAWVCTYD
LFVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UPR8	0.936	0.942	0.000	898	0.856	0.862	Q6UPR8.pdb.gz	ERMP1_RAT Endoplasmic reticulum metallopeptidase 1 OS=Rattus norvegicus OX=10116 GN=Ermp1 PE=1 SV=1
2	AFDB:Q7Z2K6	1.000	1.000	0.000	904	1.000	1.000	Q7Z2K6.pdb.gz	ERMP1_HUMAN Endoplasmic reticulum metallopeptidase 1 OS=Homo sapiens OX=9606 GN=ERMP1 PE=1 SV=2
3	AFDB:Q0WVZ7	0.794	0.789	8.133E-51	910	0.218	0.216	Q0WVZ7.pdb.gz	Q0WVZ7_ARATH 24 kDa vacuolar protein-like OS=Arabidopsis thaliana OX=3702 GN=At5g20655 PE=1 SV=1
4	AFDB:P38244	0.681	0.635	2.866E-35	976	0.168	0.156	P38244.pdb.gz	PFF1_YEAST Vacuolar membrane protease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFF1 PE=1 SV=3
5	AFDB:P81715	0.246	0.488	7.352E-13	438	0.069	0.142	P81715.pdb.gz	LIE1_STREX Leupeptin-inactivating enzyme 1 OS=Streptomyces exfoliatus OX=1905 GN=lieA PE=1 SV=2
6	AFDB:Q306T3	0.248	0.492	5.849E-12	437	0.069	0.142	Q306T3.pdb.gz	Q306T3_9ACTN Aminopeptidase OS=Streptomyces sp. KK565 OX=353796 PE=1 SV=1
7	PDB:4f9vA	0.216	0.586	6.286E-9	307	0.066	0.195	4f9vA.pdb.gz	Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
8	PDB:4faiB	0.219	0.595	2.160E-8	305	0.050	0.148	4faiB.pdb.gz	Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
9	PDB:6yi1A	0.228	0.574	4.760E-8	329	0.061	0.167	6yi1A.pdb.gz	Hydrazides Are Potent Transition-State Analogues for Glutaminyl Cyclase Implicated in the Pathogenesis of Alzheimer's Disease.
10	PDB:4tweA	0.192	0.241	8.194E-8	706	0.070	0.089	4tweA.pdb.gz	Structural and biochemical characterization of a novel aminopeptidase from human intestine.
11	PDB:6etyA	0.195	0.247	4.613E-7	696	0.053	0.069	6etyA.pdb.gz	Structural and computational basis for potent inhibition of glutamate carboxypeptidase II by carbamate-based inhibitors.
12	PDB:7d21A	0.216	0.545	5.621E-7	328	0.052	0.143	7d21A.pdb.gz	A Unique Carboxylic-Acid Hydrogen-Bond Network (CAHBN) Confers Glutaminyl Cyclase Activity on M28 Family Enzymes.
13	PDB:3fedA	0.191	0.246	1.301E-6	690	0.060	0.078	3fedA.pdb.gz	Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III
14	PDB:7zqsB	0.199	0.272	3.012E-6	639	0.050	0.070	7zqsB.pdb.gz	Discovery of a Transferrin Receptor 1-Binding Aptamer and Its Application in Cancer Cell Depletion for Adoptive T-Cell Therapy Manufacturing.
15	PDB:2zofA	0.147	0.260	6.123E-5	478	0.032	0.061	2zofA.pdb.gz	Structural basis for substrate recognition and hydrolysis by mouse carnosinase CN2.
16	PDB:4g1pA	0.149	0.260	1.284E-4	479	0.033	0.063	4g1pA.pdb.gz	Structural and Mechanistic Basis of Substrate Recognition by Novel Di-peptidase Dug1p From Saccromyces cerevesiae
17	AFDB:A0A0N4SUJ3	0.173	0.195	7.463E-4	795	0.021	0.024	A0A0N4SUJ3.pdb.gz	A0A0N4SUJ3_MOUSE N-acetylated alpha-linked acidic dipeptidase-like 2 OS=Mus musculus OX=10090 GN=Naaladl2 PE=1 SV=1
18	AFDB:Q58DX5	0.196	0.219	9.093E-4	795	0.055	0.063	Q58DX5.pdb.gz	NADL2_HUMAN Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 OS=Homo sapiens OX=9606 GN=NAALADL2 PE=1 SV=3
19	AFDB:A0MWD1	0.076	0.092	4.873E-3	710	0.080	0.101	A0MWD1.pdb.gz	MX2_BUBBU Interferon-induced GTP-binding protein Mx2 OS=Bubalus bubalis OX=89462 GN=MX2 PE=2 SV=1
20	AFDB:P9WG63	0.073	0.089	4.073E-2	695	0.077	0.101	P9WG63.pdb.gz	DIPZ_MYCTU Protein DipZ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dipZ PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UPR8	0.0	1576	898	0.856	0.862	ERMP1_RAT Endoplasmic reticulum metallopeptidase 1 OS=Rattus norvegicus OX=10116 GN=Ermp1 PE=1 SV=1
2	Q7Z2K6	0.0	1870	904	1.000	1.000	ERMP1_HUMAN Endoplasmic reticulum metallopeptidase 1 OS=Homo sapiens OX=9606 GN=ERMP1 PE=1 SV=2
3	Q0WVZ7	1.84e-58	218	910	0.192	0.191	Q0WVZ7_ARATH 24 kDa vacuolar protein-like OS=Arabidopsis thaliana OX=3702 GN=At5g20655 PE=1 SV=1
4	O94479	7.32e-26	117	843	0.103	0.110	PFF1_SCHPO Vacuolar membrane protease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1919.12c PE=3 SV=1
5	P38244	5.14e-19	95.1	976	0.079	0.073	PFF1_YEAST Vacuolar membrane protease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFF1 PE=1 SV=3
6	Q9UP52	0.026	40.8	801	0.050	0.056	TFR2_HUMAN Transferrin receptor protein 2 OS=Homo sapiens OX=9606 GN=TFR2 PE=1 SV=1
7	Q16769	0.049	39.3	361	0.040	0.100	QPCT_HUMAN Glutaminyl-peptide cyclotransferase OS=Homo sapiens OX=9606 GN=QPCT PE=1 SV=1
8	Q9M1S8	0.11	38.5	705	0.056	0.072	GCP2_ARATH Probable glutamate carboxypeptidase AMP1 OS=Arabidopsis thaliana OX=3702 GN=AMP1 PE=1 SV=3
9	B2GUY2	0.12	38.5	798	0.049	0.055	TFR2_RAT Transferrin receptor protein 2 OS=Rattus norvegicus OX=10116 GN=Tfr2 PE=2 SV=1
10	P96264	0.12	38.5	500	0.029	0.052	LPQL_MYCTU Probable lipoprotein aminopeptidase LpqL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqL PE=1 SV=1
11	C8V659	0.20	37.7	502	0.033	0.060	C8V659_EMENI Peptide hydrolase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03918 PE=3 SV=1
12	Q9JKX3	0.21	37.7	798	0.050	0.056	TFR2_MOUSE Transferrin receptor protein 2 OS=Mus musculus OX=10090 GN=Tfr2 PE=1 SV=2
13	Q86PD7	0.28	37.0	354	0.039	0.099	QPCT2_DROME Glutaminyl-peptide cyclotransferase OS=Drosophila melanogaster OX=7227 GN=isoQC PE=1 SV=1
14	P46520	0.92	33.1	95	0.023	0.221	EMP1_ORYSJ Embryonic abundant protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=EMP1 PE=2 SV=1
15	Q9NXS2	1.1	35.0	382	0.040	0.094	QPCTL_HUMAN Glutaminyl-peptide cyclotransferase-like protein OS=Homo sapiens OX=9606 GN=QPCTL PE=1 SV=2
16	B7QK46	1.7	34.7	353	0.055	0.142	QPCT_IXOSC Glutaminyl-peptide cyclotransferase OS=Ixodes scapularis OX=6945 GN=Qptc PE=1 SV=1
17	I1JLC8	1.9	32.3	105	0.022	0.190	SLE2_SOYBN Protein SLE2 OS=Glycine max OX=3847 GN=SLE2 PE=2 SV=1
18	Q7Y228	1.9	34.7	681	0.049	0.065	LAMP1_ARATH Probable glutamate carboxypeptidase LAMP1 OS=Arabidopsis thaliana OX=3702 GN=LAMP1 PE=2 SV=1
19	O49434	2.1	34.3	525	0.019	0.032	AAH_ARATH Allantoate deiminase OS=Arabidopsis thaliana OX=3702 GN=AAH PE=1 SV=2
20	Q9VRQ9	3.7	33.5	340	0.022	0.059	QPCT1_DROME Glutaminyl-peptide cyclotransferase OS=Drosophila melanogaster OX=7227 GN=QC PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01546 Peptidase_M20	8.5	17.5	Peptidase family M20/M25/M40
2	PF04389 Peptidase_M28	2.4e-44	163.0	Peptidase family M28

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340427

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310117	0.737	Protein phosphatase 1 regulatory subunit 14B
2	9606.ENSP00000338624	0.729	Threonine aspartase 1
3	9606.ENSP00000474090	0.715	Uridine phosphorylase 2
4	9606.ENSP00000330032	0.616	Uridine phosphorylase 1
5	9606.ENSP00000416696	0.585	RAB6A-GEF complex partner protein 1
6	9606.ENSP00000380747	0.574	Transmembrane protein 209
7	9606.ENSP00000350961	0.563	Distal membrane-arm assembly complex protein 1
8	9606.ENSP00000350937	0.549	Testin
9	9606.ENSP00000382071	0.542	Biotin--protein ligase
10	9606.ENSP00000258796	0.538	Protein tweety homolog 3
11	9606.ENSP00000233838	0.522	Vitamin K-dependent gamma-carboxylase
12	9606.ENSP00000409738	0.519	Protein lifeguard 3
13	9606.ENSP00000276893	0.509	E3 ubiquitin-protein ligase UHRF2
14	9606.ENSP00000301945	0.503	Anthrax toxin receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.851	catalytic activity
GO:0140096	0.740	catalytic activity, acting on a protein
GO:0016787	0.366	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.976	biological regulation
GO:0009987	0.975	cellular process
GO:0050794	0.959	regulation of cellular process
GO:0035966	0.903	response to topologically incorrect protein
GO:0006986	0.796	response to unfolded protein
GO:0007154	0.788	cell communication
GO:0035967	0.788	cellular response to topologically incorrect protein
GO:0034976	0.772	response to endoplasmic reticulum stress
GO:0034620	0.736	cellular response to unfolded protein
GO:0030968	0.726	endoplasmic reticulum unfolded protein response
GO:0062197	0.562	cellular response to chemical stress
GO:0006979	0.484	response to oxidative stress
GO:0034599	0.308	cellular response to oxidative stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.995	endomembrane system
GO:0016020	0.992	membrane
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005737	0.991	cytoplasm
GO:0005783	0.635	endoplasmic reticulum
GO:0071944	0.321	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.366	Hydrolases.

[back to server]