StarFunc result for job id Q7Z2W4

User Input

>input (902 residues)
MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGI
TRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKV
LKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRG
NCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRN
MAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQISHRASLEDAPVDDLTRKFTYL
GSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLASNSTSAPNWK
SLTSWTNDQGARRKTVFSPTLPAARSSLGSLQTPEAVTTRKGTGLLSSDYRIINGKSGTQ
DIQPGPLFNNNADGVATDITSTRSLNYKSTSSGHREISSPRIQDAGPASRDVQATGRIAD
DADPRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHLCKGCPLNGSCSKVHFHLPYRWQM
LIGKTWTDFEHMETIEKGYCNPGIHLCSVGSYTINFRVMSCDSFPIRRLSTPSSVTKPAN
SVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSRNYE
LSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPDHQPAKTSSVSLTATFRPQEDF
CFLSSKKYKLSEIHHLHPEYVRVSEHFKASMKNFKIEKIKKIENSELLDKFTWKKSQMKE
EGKLLFYATSRAYVESICSNNFDSFLHETHENKYGKGIYFAKDAIYSHKNCPYDAKNVVM
FVAQVLVGKFTEGNITYTSPPPQFDSCVDTRSNPSVFVIFQKDQVYPQYVIEYTEDKACV
IS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C9J6P4	0.445	0.401	0.000	1024	0.998	0.879	C9J6P4.pdb.gz	C9J6P4_HUMAN Zinc finger CCCH-type containing, antiviral 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=1
2	AFDB:Q7Z2W4	1.000	1.000	0.000	902	1.000	1.000	Q7Z2W4.pdb.gz	ZCCHV_HUMAN Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3
3	AFDB:Q3UPF5	0.304	0.292	1.385E-77	946	0.493	0.470	Q3UPF5.pdb.gz	ZCCHV_MOUSE Zinc finger CCCH-type antiviral protein 1 OS=Mus musculus OX=10090 GN=Zc3hav1 PE=1 SV=1
4	AFDB:Q8K3Y6	0.304	0.347	2.859E-67	776	0.435	0.505	Q8K3Y6.pdb.gz	ZCCHV_RAT Zinc finger CCCH-type antiviral protein 1 OS=Rattus norvegicus OX=10116 GN=Zc3hav1 PE=1 SV=1
5	PDB:6x0lP	0.159	0.291	6.773E-8	474	0.029	0.055	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
6	AFDB:Q9UKK3	0.165	0.089	6.620E-3	1724	0.039	0.020	Q9UKK3.pdb.gz	PARP4_HUMAN Protein mono-ADP-ribosyltransferase PARP4 OS=Homo sapiens OX=9606 GN=PARP4 PE=1 SV=3
7	PDB:7mopA	0.070	0.026	7.624E-2	2445	0.023	0.009	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
8	PDB:7jq9A	0.070	0.027	1.514E-1	2427	0.023	0.009	7jq9A.pdb.gz
9	AFDB:A0A140LH27	0.064	0.044	5.017E-1	1664	0.095	0.052	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
10	AFDB:P37275	0.046	0.039	5.017E-1	1124	0.060	0.048	P37275.pdb.gz	ZEB1_HUMAN Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2
11	AFDB:Q4WEP7	0.045	0.046	8.067E-1	888	0.090	0.091	Q4WEP7.pdb.gz	CHIA1_ASPFU Endochitinase A1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=chiA1 PE=3 SV=1
12	AFDB:Q64318	0.043	0.036	8.965E-1	1117	0.089	0.072	Q64318.pdb.gz	ZEB1_MOUSE Zinc finger E-box-binding homeobox 1 OS=Mus musculus OX=10090 GN=Zeb1 PE=1 SV=1
13	PDB:1z9cC	0.057	0.319	1.250	138	0.008	0.051	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
14	PDB:6o9lQ	0.056	0.110	1.250	430	0.010	0.021	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
15	PDB:7qcdE	0.053	0.169	1.390	261	0.010	0.034	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
16	AFDB:A0A024QZ26	0.041	0.033	1.689	1215	0.071	0.053	A0A024QZ26.pdb.gz
17	PDB:2mphA	0.048	0.103	2.011	224	0.023	0.094	2mphA.pdb.gz
18	PDB:2wnrB	0.029	0.087	2.011	222	0.006	0.023	2wnrB.pdb.gz	Structure of the Methanothermobacter Thermautotrophicus Exosome Rnase Ph Ring
19	PDB:5gai0	0.030	0.038	2.011	662	0.014	0.020	5gai0.pdb.gz
20	PDB:2mv2A	0.025	0.099	2.120	148	0.017	0.101	2mv2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J6P4	0.0	1025	1024	0.548	0.482	C9J6P4_HUMAN Zinc finger CCCH-type containing, antiviral 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=1
2	Q7Z2W4	0.0	1895	902	1.000	1.000	ZCCHV_HUMAN Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3
3	Q3UPF5	9.41e-167	512	946	0.304	0.290	ZCCHV_MOUSE Zinc finger CCCH-type antiviral protein 1 OS=Mus musculus OX=10090 GN=Zc3hav1 PE=1 SV=1
4	Q8K3Y6	1.22e-164	501	776	0.269	0.313	ZCCHV_RAT Zinc finger CCCH-type antiviral protein 1 OS=Rattus norvegicus OX=10116 GN=Zc3hav1 PE=1 SV=1
5	Q9H0J9	1.21e-86	293	701	0.184	0.237	PAR12_HUMAN Protein mono-ADP-ribosyltransferase PARP12 OS=Homo sapiens OX=9606 GN=PARP12 PE=1 SV=1
6	Q96H79	1.08e-48	177	300	0.109	0.327	ZCCHL_HUMAN Zinc finger CCCH-type antiviral protein 1-like OS=Homo sapiens OX=9606 GN=ZC3HAV1L PE=1 SV=2
7	Q9NR21	3.01e-37	145	338	0.103	0.275	PAR11_HUMAN Protein mono-ADP-ribosyltransferase PARP11 OS=Homo sapiens OX=9606 GN=PARP11 PE=1 SV=2
8	Q8CFF0	3.17e-36	142	331	0.102	0.278	PAR11_MOUSE Protein mono-ADP-ribosyltransferase PARP11 OS=Mus musculus OX=10090 GN=Parp11 PE=2 SV=1
9	F1N973	7.64e-34	141	670	0.170	0.228	F1N973_CHICK TCDD inducible poly(ADP-ribose) polymerase OS=Gallus gallus OX=9031 GN=TIPARP PE=3 SV=2
10	A0A0R4IVH6	1.01e-32	137	646	0.150	0.209	A0A0R4IVH6_DANRE TCDD-inducible poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=fc03g05 PE=3 SV=1
11	Q7Z3E1	1.33e-32	137	657	0.136	0.187	PARPT_HUMAN Protein mono-ADP-ribosyltransferase TIPARP OS=Homo sapiens OX=9606 GN=TIPARP PE=1 SV=1
12	Q05BQ2	2.09e-32	136	660	0.136	0.186	Q05BQ2_HUMAN TIPARP protein (Fragment) OS=Homo sapiens OX=9606 GN=TIPARP PE=2 SV=1
13	Q8C1B2	6.41e-32	135	657	0.137	0.189	PARPT_MOUSE Protein mono-ADP-ribosyltransferase TIPARP OS=Mus musculus OX=10090 GN=Tiparp PE=2 SV=1
14	D3ZMH5	6.59e-32	135	657	0.137	0.189	D3ZMH5_RAT TCDD-inducible poly(ADP-ribose) polymerase OS=Rattus norvegicus OX=10116 GN=Tiparp PE=3 SV=1
15	A0A8I6GA83	8.20e-32	135	688	0.137	0.180	A0A8I6GA83_RAT TCDD-inducible poly(ADP-ribose) polymerase OS=Rattus norvegicus OX=10116 GN=Tiparp PE=3 SV=1
16	Q460N3	9.98e-22	103	678	0.080	0.106	PAR15_HUMAN Protein mono-ADP-ribosyltransferase PARP15 OS=Homo sapiens OX=9606 GN=PARP15 PE=1 SV=2
17	Q2EMV9	9.84e-19	94.7	1817	0.068	0.034	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
18	Q460N5	1.37e-15	84.3	1801	0.067	0.033	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
19	E9PNI7	4.48e-12	72.8	1037	0.047	0.041	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
20	E9PK67	5.00e-12	72.4	1016	0.047	0.041	E9PK67_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18606 HTH_53	1.7e-29	112.6	Zap helix turn helix N-terminal domain
2	PF00644 PARP	1.5e-18	78.6	Poly(ADP-ribose) polymerase catalytic domain
3	PF02825 WWE	4.8e-10	51.2	WWE domain
4	PF09280 XPC-binding	6.5e+02	11.4	XPC-binding domain
5	PF18633 zf-CCCH_8	2.9e-13	60.9	Zinc-finger antiviral protein (ZAP) zinc finger domain 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369213	0.983	Probable ATP-dependent RNA helicase DDX58
2	9606.ENSP00000221233	0.963	Exosome complex component RRP46
3	9606.ENSP00000323889	0.936	E3 ubiquitin/ISG15 ligase TRIM25
4	9606.ENSP00000251849	0.914	RAF proto-oncogene serine/threonine-protein kinase
5	9606.ENSP00000371067	0.904	Tyrosine-protein kinase JAK2
6	9606.ENSP00000319060	0.902	Calcium/calmodulin-dependent protein kinase type II subunit gamma
7	9606.ENSP00000290277	0.901	Serine/threonine-protein kinase A-Raf
8	9606.ENSP00000339740	0.900	Calcium/calmodulin-dependent protein kinase type II subunit delta
9	9606.ENSP00000379098	0.900	Calcium/calmodulin-dependent protein kinase type II subunit beta
10	9606.ENSP00000381412	0.900	Calcium/calmodulin-dependent protein kinase type II subunit alpha
11	9606.ENSP00000251343	0.803	Protein KHNYN
12	9606.ENSP00000380033	0.765	Probable ATP-dependent RNA helicase DDX17
13	9606.ENSP00000293831	0.725	Eukaryotic initiation factor 4A-I
14	9606.ENSP00000341597	0.699	Protein FAM114A2
15	9606.ENSP00000361626	0.699	Nuclease-sensitive element-binding protein 1
16	9606.ENSP00000381740	0.693	Poly [ADP-ribose] polymerase 3
17	9606.ENSP00000387911	0.693	Poly(A)-specific ribonuclease PARN
18	9606.ENSP00000399797	0.690	Putative helicase MOV-10
19	9606.ENSP00000220592	0.686	Protein argonaute-2
20	9606.ENSP00000261888	0.684	Mono [ADP-ribose] polymerase PARP16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding
GO:0003723	1.000	RNA binding
GO:0003824	0.877	catalytic activity
GO:0016740	0.772	transferase activity
GO:0140096	0.433	catalytic activity, acting on a protein
GO:0016763	0.415	pentosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0048518	0.990	positive regulation of biological process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0048522	0.984	positive regulation of cellular process
GO:0045089	0.979	positive regulation of innate immune response
GO:0032481	0.977	positive regulation of type I interferon production
GO:0062207	0.975	regulation of pattern recognition receptor signaling pathway
GO:0009967	0.968	positive regulation of signal transduction
GO:0080090	0.956	regulation of primary metabolic process
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0048519	0.955	negative regulation of biological process
GO:0062208	0.954	positive regulation of pattern recognition receptor signaling pathway
GO:0031323	0.945	regulation of cellular metabolic process
GO:1903900	0.932	regulation of viral life cycle
GO:0019219	0.919	regulation of nucleobase-containing compound metabolic process
GO:0045069	0.918	regulation of viral genome replication
GO:0051173	0.913	positive regulation of nitrogen compound metabolic process
GO:0009894	0.903	regulation of catabolic process
GO:0043122	0.896	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048525	0.892	negative regulation of viral process
GO:0039531	0.884	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0009615	0.881	response to virus
GO:0045071	0.874	negative regulation of viral genome replication
GO:1902533	0.870	positive regulation of intracellular signal transduction
GO:0051252	0.863	regulation of RNA metabolic process
GO:0045935	0.849	positive regulation of nucleobase-containing compound metabolic process
GO:0061014	0.840	positive regulation of mRNA catabolic process
GO:0009987	0.790	cellular process
GO:0043123	0.743	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032728	0.719	positive regulation of interferon-beta production
GO:0032647	0.713	regulation of interferon-alpha production
GO:0071704	0.581	organic substance metabolic process
GO:0044238	0.523	primary metabolic process
GO:0006807	0.513	nitrogen compound metabolic process
GO:0043170	0.448	macromolecule metabolic process
GO:0051716	0.355	cellular response to stimulus
GO:0006950	0.350	response to stress
GO:0044237	0.313	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	0.959	nucleus
GO:0043232	0.480	intracellular non-membrane-bounded organelle
GO:0070013	0.475	intracellular organelle lumen
GO:0031981	0.466	nuclear lumen
GO:0016020	0.419	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.772	Transferases.
EC:2.4.2.-	0.415	Pentosyltransferases.

[back to server]