StarFunc result for job id Q7Z2W7

User Input

>input (1104 residues)
MSFRAARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFKKRECVFFTKD
SKATENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRL
SCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIL
TGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEGYFLAQY
LMDDFTRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
IVCFAQGGGKETLKAINTSIKNKIPCVVVEGSGQIADVIASLVEVEDALTSSAVKEKLVR
FLPRTVSRLPEEETESWIKWLKEILECSHLLTVIKMEEAGDEIVSNAISYALYKAFSTSE
QDKDNWNGQLKLLLEWNQLDLANDEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLEN
GLNLRKFLTHDVLTELFSNHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRGFRKEDR
NGRDEMDIELHDVSPITRHPLQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKT
LAKVKNDINAAGESEELANEYETRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELA
VEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGFVSFRKKPVDKH
KKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFAYVLLMDFHSVPHPPELVLYSLVFVLFC
DEVRQWYVNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFT
LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIF
RSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV
CIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCSRLNIPFPFIVFAY
FYMVVKKCFKCCCKEKNMESSVCCFKNEDNETLAWEGVMKENYLVKINTKANDTSEEMRH
RFRQLDTKLNDLKGLLKEIANKIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z2W7	1.000	1.000	0.000	1104	1.000	1.000	Q7Z2W7.pdb.gz	TRPM8_HUMAN Transient receptor potential cation channel subfamily M member 8 OS=Homo sapiens OX=9606 GN=TRPM8 PE=1 SV=2
2	AFDB:U3JD03	0.928	0.919	0.000	1115	0.803	0.796	U3JD03.pdb.gz	U3JD03_FICAL Transient receptor potential cation channel subfamily M member 8 OS=Ficedula albicollis OX=59894 PE=1 SV=2
3	PDB:7wrbA	0.755	0.889	4.558E-100	930	0.803	0.954	7wrbA.pdb.gz	Structures of a mammalian TRPM8 in closed state.
4	PDB:8e4nA	0.724	0.877	1.123E-97	901	0.774	0.949	8e4nA.pdb.gz	Activation mechanism of the mouse cold-sensing TRPM8 channel by cooling agonist and PIP 2.
5	PDB:8e4qA	0.697	0.848	3.894E-86	894	0.695	0.858	8e4qA.pdb.gz
6	AFDB:E9PTA2	0.827	0.618	9.001E-84	1507	0.427	0.313	E9PTA2.pdb.gz	TRPM2_RAT Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3
7	AFDB:A0A0R4IMY7	0.821	0.630	2.929E-83	1470	0.413	0.310	A0A0R4IMY7.pdb.gz	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
8	AFDB:O94759	0.828	0.622	2.929E-83	1503	0.415	0.305	O94759.pdb.gz	TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2
9	AFDB:I3IS25	0.732	0.650	2.860E-72	1260	0.341	0.298	I3IS25.pdb.gz
10	AFDB:Q8TD43	0.823	0.752	3.718E-72	1214	0.336	0.306	Q8TD43.pdb.gz	TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens OX=9606 GN=TRPM4 PE=1 SV=1
11	AFDB:Q7TN37	0.759	0.697	4.626E-72	1213	0.337	0.307	Q7TN37.pdb.gz	TRPM4_MOUSE Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1
12	AFDB:A7T1N0	0.799	0.582	4.228E-69	1551	0.326	0.232	A7T1N0.pdb.gz	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
13	PDB:6puuA	0.725	0.622	6.377E-66	1309	0.402	0.339	6puuA.pdb.gz	Ligand recognition and gating mechanism through three ligand-binding sites of human TRPM2 channel.
14	AFDB:Q9NZQ8	0.743	0.707	1.834E-63	1165	0.325	0.308	Q9NZQ8.pdb.gz	TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1
15	PDB:6drjA	0.711	0.630	6.089E-63	1266	0.403	0.352	6drjA.pdb.gz	Architecture of the TRPM2 channel and its activation mechanism by ADP-ribose and calcium.
16	PDB:6pkxB	0.688	0.630	2.929E-59	1218	0.386	0.350	6pkxB.pdb.gz	Visualizing structural transitions of ligand-dependent gating of the TRPM2 channel.
17	PDB:6bcqB	0.628	0.693	7.216E-57	983	0.313	0.352	6bcqB.pdb.gz	Structures of the calcium-activated, non-selective cation channel TRPM4.
18	PDB:6co7A	0.728	0.755	9.379E-57	1061	0.310	0.322	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
19	PDB:6bqrA	0.634	0.723	4.330E-56	948	0.304	0.354	6bqrA.pdb.gz	Structure of the human TRPM4 ion channel in a lipid nanodisc.
20	PDB:6mj2A	0.685	0.580	6.142E-56	1337	0.398	0.328	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IMY7	0.0	796	1470	0.425	0.319	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
2	E9PTA2	0.0	828	1507	0.435	0.319	TRPM2_RAT Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3
3	O94759	0.0	814	1503	0.417	0.306	TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2
4	Q7Z2W7	0.0	2295	1104	1.000	1.000	TRPM8_HUMAN Transient receptor potential cation channel subfamily M member 8 OS=Homo sapiens OX=9606 GN=TRPM8 PE=1 SV=2
5	Q8R455	0.0	2128	1104	0.938	0.938	TRPM8_RAT Transient receptor potential cation channel subfamily M member 8 OS=Rattus norvegicus OX=10116 GN=Trpm8 PE=1 SV=4
6	Q8R4D5	0.0	2129	1104	0.938	0.938	TRPM8_MOUSE Transient receptor potential cation channel subfamily M member 8 OS=Mus musculus OX=10090 GN=Trpm8 PE=1 SV=3
7	Q91YD4	0.0	818	1506	0.426	0.312	TRPM2_MOUSE Transient receptor potential cation channel subfamily M member 2 OS=Mus musculus OX=10090 GN=Trpm2 PE=1 SV=2
8	U3JD03	0.0	1862	1115	0.804	0.796	U3JD03_FICAL Transient receptor potential cation channel subfamily M member 8 OS=Ficedula albicollis OX=59894 PE=1 SV=2
9	Q7TN37	2.64e-179	559	1213	0.342	0.312	TRPM4_MOUSE Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1
10	Q9NZQ8	9.45e-179	556	1165	0.340	0.322	TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1
11	Q9ESQ5	2.33e-176	551	1208	0.341	0.311	TRPM4_RAT Transient receptor potential cation channel subfamily M member 4 OS=Rattus norvegicus OX=10116 GN=Trpm4 PE=1 SV=2
12	A0A455XI77	2.47e-175	547	1156	0.332	0.317	A0A455XI77_RAT Transient receptor potential cation channel subfamily M member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=2 SV=1
13	A0A8I6AG64	3.21e-175	547	1164	0.332	0.314	A0A8I6AG64_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=1
14	F1LMD7	3.54e-175	548	1187	0.332	0.308	F1LMD7_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=3
15	Q9JJH7	4.89e-175	546	1158	0.328	0.313	TRPM5_MOUSE Transient receptor potential cation channel subfamily M member 5 OS=Mus musculus OX=10090 GN=Trpm5 PE=1 SV=1
16	Q8TD43	3.83e-170	535	1214	0.347	0.315	TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens OX=9606 GN=TRPM4 PE=1 SV=1
17	A7T1N0	1.31e-111	382	1551	0.218	0.155	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
18	Q8CIR4	1.27e-104	365	2028	0.269	0.146	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
19	Q9BX84	5.95e-98	345	2022	0.255	0.139	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
20	Q9HCF6	6.47e-90	320	1732	0.207	0.132	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00520 Ion_trans	5.3e-07	40.7	Ion transport protein
2	PF18139 LSDAT_euk	1.1e-61	220.1	SLOG in TRPM
3	PF18171 LSDAT_prok	1.7e-15	68.2	SLOG in TRPM, prokaryote

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323926

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000459962	0.977	Transient receptor potential cation channel, subfamily V, member 1
2	9606.ENSP00000262209	0.960	Transient receptor potential cation channel subfamily A member 1
3	9606.ENSP00000461007	0.960	Transient receptor potential cation channel subfamily V member 1
4	9606.ENSP00000301365	0.950	Transient receptor potential cation channel subfamily V member 3
5	9606.ENSP00000406191	0.922	Transient receptor potential cation channel subfamily V member 4
6	9606.ENSP00000342222	0.898	Transient receptor potential cation channel subfamily V member 2
7	9606.ENSP00000352358	0.807	Transient receptor potential cation channel subfamily V member 6
8	9606.ENSP00000326031	0.804	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
9	9606.ENSP00000341779	0.804	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
10	9606.ENSP00000378769	0.804	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
11	9606.ENSP00000286548	0.800	Guanine nucleotide-binding protein G(q) subunit alpha
12	9606.ENSP00000265310	0.746	Transient receptor potential cation channel subfamily V member 5
13	9606.ENSP00000265709	0.742	Ankyrin-1
14	9606.ENSP00000462046	0.742	Phosphoinositide-interacting protein
15	9606.ENSP00000390600	0.700	Sodium channel protein type 10 subunit alpha
16	9606.ENSP00000394033	0.683	Potassium channel subfamily K member 2
17	9606.ENSP00000444948	0.671	Potassium channel subfamily K member 4
18	9606.ENSP00000310631	0.663	Mas-related G-protein coupled receptor member D
19	9606.ENSP00000264079	0.653	Mucolipin-1
20	9606.ENSP00000331746	0.648	Calcitonin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005262	0.998	calcium channel activity
GO:0042802	0.961	identical protein binding
GO:0022839	0.913	monoatomic ion gated channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.980	cellular process
GO:0050896	0.970	response to stimulus
GO:0030001	0.949	metal ion transport
GO:0006816	0.944	calcium ion transport
GO:0065007	0.821	biological regulation
GO:0050789	0.754	regulation of biological process
GO:0055085	0.753	transmembrane transport
GO:0034220	0.692	monoatomic ion transmembrane transport
GO:0098660	0.665	inorganic ion transmembrane transport
GO:0098662	0.663	inorganic cation transmembrane transport
GO:0098655	0.641	monoatomic cation transmembrane transport
GO:0070588	0.573	calcium ion transmembrane transport
GO:0032501	0.549	multicellular organismal process
GO:0050794	0.520	regulation of cellular process
GO:0006950	0.423	response to stress
GO:0009628	0.383	response to abiotic stimulus
GO:0048518	0.312	positive regulation of biological process
GO:0009409	0.300	response to cold

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.453	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.998	Ca(2+)(in) = Ca(2+)(out)

[back to server]