StarFunc result for job id Q7Z2X4

User Input

>input (250 residues)
MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKK
EPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWK
KHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIF
AWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEE
VSQELESDDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z2X4	1.000	1.000	7.839E-46	250	1.000	1.000	Q7Z2X4.pdb.gz	PCLI1_HUMAN PTB-containing, cubilin and LRP1-interacting protein OS=Homo sapiens OX=9606 GN=PID1 PE=1 SV=1
2	AFDB:F1R0I6	0.480	0.399	1.309E-10	305	0.220	0.180	F1R0I6.pdb.gz
3	AFDB:Q8N2R8	0.494	0.300	4.170E-9	423	0.180	0.106	Q8N2R8.pdb.gz	FA43A_HUMAN Protein FAM43A OS=Homo sapiens OX=9606 GN=FAM43A PE=1 SV=2
4	AFDB:F1LJ00	0.398	0.139	7.765E-8	815	0.168	0.052	F1LJ00.pdb.gz	F1LJ00_HUMAN TBC1 domain family, member 18 OS=Homo sapiens OX=9606 GN=TBC1D18 PE=2 SV=1
5	AFDB:Q6S5L8	0.425	0.179	4.652E-7	630	0.148	0.059	Q6S5L8.pdb.gz	SHC4_HUMAN SHC-transforming protein 4 OS=Homo sapiens OX=9606 GN=SHC4 PE=1 SV=1
6	AFDB:Q49AR9	0.461	0.211	4.939E-7	570	0.116	0.051	Q49AR9.pdb.gz	Q49AR9_HUMAN ANKS1A protein OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
7	AFDB:E7EX91	0.450	0.344	7.499E-7	339	0.132	0.097	E7EX91.pdb.gz	E7EX91_HUMAN Amyloid beta precursor protein binding family B member 3 OS=Homo sapiens OX=9606 GN=APBB3 PE=1 SV=1
8	AFDB:P46933	0.433	0.165	7.961E-7	711	0.132	0.046	P46933.pdb.gz	APBB1_RAT Amyloid beta precursor protein binding family B member 1 OS=Rattus norvegicus OX=10116 GN=Apbb1 PE=1 SV=3
9	AFDB:Q6S5L9	0.430	0.184	1.362E-6	626	0.156	0.062	Q6S5L9.pdb.gz	SHC4_MOUSE SHC-transforming protein 4 OS=Mus musculus OX=10090 GN=Shc4 PE=1 SV=1
10	AFDB:Q9Y3P9	0.358	0.097	1.446E-6	1069	0.164	0.038	Q9Y3P9.pdb.gz	RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3
11	PDB:6oxlN	0.253	0.453	6.879E-3	124	0.044	0.089	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
12	PDB:1k5dB	0.239	0.363	8.734E-3	146	0.088	0.151	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
13	PDB:5oqj1	0.278	0.154	1.586E-2	491	0.032	0.016	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
14	PDB:3rt0C	0.113	0.141	3.658E-2	172	0.048	0.070	3rt0C.pdb.gz	The Molecular Basis of ABA-Independent Inhibition of PP2Cs by a Subclass of PYL Proteins
15	PDB:3m1iB	0.239	0.404	4.375E-2	131	0.052	0.099	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
16	PDB:3kq0A	0.133	0.178	4.644E-2	175	0.024	0.034	3kq0A.pdb.gz	The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.
17	PDB:4mt6A	0.253	0.171	4.930E-2	389	0.052	0.033	4mt6A.pdb.gz
18	PDB:6bbpA	0.230	0.119	5.233E-2	520	0.044	0.021	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:4adnA	0.181	0.205	6.259E-2	213	0.044	0.052	4adnA.pdb.gz	Structure and Function of Fusb: An Elongation Factor G-Binding Fusidic Acid Resistance Protein Active in Ribosomal Translocation and Recycling
20	PDB:3tgoD	0.127	0.157	6.644E-2	186	0.064	0.086	3tgoD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z2X4	0.0	521	250	1.000	1.000	PCLI1_HUMAN PTB-containing, cubilin and LRP1-interacting protein OS=Homo sapiens OX=9606 GN=PID1 PE=1 SV=1
2	Q3UBG2	3.87e-152	424	217	0.796	0.917	PCLI1_MOUSE PTB-containing, cubilin and LRP1-interacting protein OS=Mus musculus OX=10090 GN=Pid1 PE=1 SV=2
3	Q66I09	5.63e-07	51.6	303	0.188	0.155	Q66I09_DANRE Protein FAM43B OS=Danio rerio OX=7955 GN=zgc:92105 PE=2 SV=1
4	Q8N2R8	2.64e-05	47.0	423	0.132	0.078	FA43A_HUMAN Protein FAM43A OS=Homo sapiens OX=9606 GN=FAM43A PE=1 SV=2
5	Q8C142	0.23	34.7	308	0.068	0.055	ARH_MOUSE Low density lipoprotein receptor adapter protein 1 OS=Mus musculus OX=10090 GN=Ldlrap1 PE=1 SV=3
6	Q5SW96	0.43	33.9	308	0.068	0.055	ARH_HUMAN Low density lipoprotein receptor adapter protein 1 OS=Homo sapiens OX=9606 GN=LDLRAP1 PE=1 SV=3
7	P31040	0.85	33.5	664	0.060	0.023	SDHA_HUMAN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2
8	D6RFM5	0.92	33.1	583	0.060	0.026	D6RFM5_HUMAN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=1
9	Q8K2B3	1.2	32.7	664	0.056	0.021	SDHA_MOUSE Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1
10	Q0QF01	1.4	32.7	664	0.060	0.023	SDHA_PIG Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Sus scrofa OX=9823 GN=SDHA PE=1 SV=2
11	O77375	1.5	32.7	2457	0.076	0.008	O77375_PLAF7 DNA-directed RNA polymerase subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0318200 PE=3 SV=1
12	D3ZAR1	1.6	32.3	306	0.064	0.052	ARH_RAT Low density lipoprotein receptor adapter protein 1 OS=Rattus norvegicus OX=10116 GN=Ldlrap1 PE=1 SV=2
13	Q9YHT1	3.7	31.2	665	0.056	0.021	SDHA_CHICK Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Gallus gallus OX=9031 GN=SDHA PE=1 SV=2
14	P31039	4.1	31.2	665	0.052	0.020	SDHA_BOVIN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Bos taurus OX=9913 GN=SDHA PE=1 SV=3
15	Q920L2	5.5	30.8	656	0.052	0.020	SDHA_RAT Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sdha PE=1 SV=1
16	P06856	8.9	30.0	1006	0.048	0.012	DPOL_VACCW DNA polymerase OS=Vaccinia virus (strain Western Reserve) OX=10254 GN=OPG071 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00640 PID	0.0054	28.2	Phosphotyrosine interaction domain (PTB/PID)
2	PF14719 PID_2	1.8e-15	68.9	Phosphotyrosine interaction domain (PTB/PID)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000022234

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000006437	0.720	Succinate dehydrogenase assembly factor 2, mitochondrial
2	9598.ENSPTRP00000017404	0.564	Guanine nucleotide-binding protein subunit gamma
3	9598.ENSPTRP00000038828	0.552	Uncharacterized protein
4	9598.ENSPTRP00000005759	0.550	Uncharacterized protein
5	9598.ENSPTRP00000008451	0.540	Transcription factor CP2
6	9598.ENSPTRP00000006709	0.535	K(lysine) acetyltransferase 5
7	9598.ENSPTRP00000020212	0.534	Sorting nexin 17
8	9598.ENSPTRP00000007678	0.522	Neurotrimin
9	9598.ENSPTRP00000045525	0.507	Myosin, light chain 4, alkali atrial, embryonic
10	9598.ENSPTRP00000003542	0.504	Component of oligomeric golgi complex 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.987	regulation of biological process
GO:0030808	0.982	regulation of nucleotide biosynthetic process
GO:0032879	0.974	regulation of localization
GO:1900542	0.967	regulation of purine nucleotide metabolic process
GO:0010827	0.963	regulation of glucose transmembrane transport
GO:0048523	0.959	negative regulation of cellular process
GO:0048522	0.957	positive regulation of cellular process
GO:2000377	0.941	regulation of reactive oxygen species metabolic process
GO:1903578	0.935	regulation of ATP metabolic process
GO:0009893	0.920	positive regulation of metabolic process
GO:0051173	0.914	positive regulation of nitrogen compound metabolic process
GO:0051881	0.913	regulation of mitochondrial membrane potential
GO:0031325	0.912	positive regulation of cellular metabolic process
GO:0060255	0.906	regulation of macromolecule metabolic process
GO:0046324	0.890	regulation of glucose import
GO:1900371	0.885	regulation of purine nucleotide biosynthetic process
GO:0045935	0.879	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.876	positive regulation of cellular biosynthetic process
GO:0034763	0.874	negative regulation of transmembrane transport
GO:0008152	0.819	metabolic process
GO:0044237	0.689	cellular metabolic process
GO:0048583	0.601	regulation of response to stimulus
GO:0009966	0.587	regulation of signal transduction
GO:0010468	0.558	regulation of gene expression
GO:0010604	0.526	positive regulation of macromolecule metabolic process
GO:0060341	0.503	regulation of cellular localization
GO:0032880	0.480	regulation of protein localization
GO:0009892	0.398	negative regulation of metabolic process
GO:0032502	0.383	developmental process
GO:0071840	0.379	cellular component organization or biogenesis
GO:0048856	0.366	anatomical structure development
GO:0016043	0.337	cellular component organization
GO:0031324	0.322	negative regulation of cellular metabolic process
GO:0050896	0.319	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.565	organelle
GO:0043227	0.525	membrane-bounded organelle
GO:0043231	0.497	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]