StarFunc result for job id Q7Z2Y5

User Input

>input (1582 residues)
MAGPGGWRDREVTDLGHLPDPTGIFSLDKTIGLGTYGRIYLGLHEKTGAFTAVKVMNARK
TPLPEIGRRVRVNKYQKSVGWRYSDEEEDLRTELNLLRKYSFHKNIVSFYGAFFKLSPPG
QRHQLWMVMELCAAGSVTDVVRMTSNQSLKEDWIAYICREILQGLAHLHAHRVIHRDIKG
QNVLLTHNAEVKLVDFGVSAQVSRTNGRRNSFIGTPYWMAPEVIDCDEDPRRSYDYRSDV
WSVGITAIEMAEGAPPLCNLQPLEALFVILRESAPTVKSSGWSRKFHNFMEKCTIKNFLF
RPTSANMLQHPFVRDIKNERHVVESLTRHLTGIIKKRQKKGIPLIFEREEAIKEQYTVRR
FRGPSCTHELLRLPTSSRCRPLRVLHGEPSQPRWLPDREEPQVQALQQLQGAARVFMPLQ
ALDSAPKPLKGQAQAPQRLQGAARVFMPLQAQVKAKASKPLQMQIKAPPRLRRAARVLMP
LQAQVRAPRLLQVQSQVSKKQQAQTQTSEPQDLDQVPEEFQGQDQVPEQQRQGQAPEQQQ
RHNQVPEQELEQNQAPEQPEVQEQAAEPAQAETEAEEPESLRVNAQVFLPLLSQDHHVLL
PLHLDTQVLIPVEGQTEGSPQAQAWTLEPPQAIGSVQALIEGLSRDLLRAPNSNNSKPLG
PLQTLMENLSSNRFYSQPEQAREKKSKVSTLRQALAKRLSPKRFRAKSSWRPEKLELSDL
EARRQRRQRRWEDIFNQHEEELRQVDKDKEDESSDNDEVFHSIQAEVQIEPLKPYISNPK
KIEVQERSPSVPNNQDHAHHVKFSSSVPQRSLLEQAQKPIDIRQRSSQNRQNWLAASESS
SEEESPVTGRRSQSSPPYSTIDQKLLVDIHVPDGFKVGKISPPVYLTNEWVGYNALSEIF
RNDWLTPAPVIQPPEEDGDYVELYDASADTDGDDDDESNDTFEDTYDHANGNDDLDNQVD
QANDVCKDHDDDNNKFVDDVNNNYYEAPSCPRASYGRDGSCKQDGYDGSRGKEEAYRGYG
SHTANRSHGGSAASEDNAAIGDQEEHAANIGSERRGSEGDGGKGVVRTSEESGALGLNGE
ENCSETDGPGLKRPASQDFEYLQEEPGGGNEASNAIDSGAAPSAPDHESDNKDISESSTQ
SDFSANHSSPSKGSGMSADANFASAILYAGFVEVPEESPKQPSEVNVNPLYVSPACKKPL
IHMYEKEFTSEICCGSLWGVNLLLGTRSNLYLMDRSGKADITKLIRRRPFRQIQVLEPLN
LLITISGHKNRLRVYHLTWLRNKILNNDPESKRRQEEMLKTEEACKAIDKLTGCEHFSVL
QHEETTYIAIALKSSIHLYAWAPKSFDESTAIKVCIDQSADSEGDYMSYQAYIRILAKIQ
AADPVNRFKRPDELLHLLKLKVFPTLDHKPVTVDLAIGSEKRLKIFFSSADGYHLIDAES
EVMSDVTLPKNPLEIIIPQNIIILPDCLGIGMMLTFNAEALSVEANEQLFKKILEMWKDI
PSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRN
HHSRVYFMTLGKLEELQSNYDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R0G8	0.385	0.415	0.000	1455	0.642	0.698	Q9R0G8.pdb.gz	NRK_MOUSE Nik-related protein kinase OS=Mus musculus OX=10090 GN=Nrk PE=1 SV=2
2	AFDB:Q9W002	0.209	0.219	1.425E-65	1504	0.283	0.298	Q9W002.pdb.gz	Q9W002_DROME Misshapen, isoform A OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=3
3	AFDB:F1M754	0.170	0.223	6.352E-55	1178	0.257	0.346	F1M754.pdb.gz	F1M754_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=3
4	AFDB:P38692	0.175	0.255	1.704E-26	1080	0.136	0.199	P38692.pdb.gz	KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIC1 PE=1 SV=1
5	AFDB:P34244	0.164	0.170	1.469E-22	1518	0.134	0.140	P34244.pdb.gz	HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSL1 PE=1 SV=2
6	AFDB:A1ZBC4	0.161	0.172	3.035E-20	1471	0.138	0.148	A1ZBC4.pdb.gz	A1ZBC4_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Sik3 PE=3 SV=2
7	AFDB:Q9TW45	0.159	0.209	1.859E-19	1192	0.119	0.158	Q9TW45.pdb.gz	PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans OX=6239 GN=par-1 PE=1 SV=1
8	AFDB:Q9R1L5	0.169	0.170	3.717E-19	1570	0.146	0.147	Q9R1L5.pdb.gz	MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Mast1 PE=1 SV=3
9	PDB:3eqdA	0.160	0.738	2.331E-18	315	0.054	0.270	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
10	AFDB:Q9VUQ9	0.164	0.123	3.135E-18	2139	0.130	0.096	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
11	AFDB:Q60592	0.163	0.149	3.880E-18	1734	0.126	0.115	Q60592.pdb.gz	MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Mast2 PE=1 SV=1
12	PDB:4eomC	0.158	0.852	5.185E-18	276	0.042	0.239	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
13	PDB:5u6yA	0.153	0.502	7.139E-18	459	0.049	0.168	5u6yA.pdb.gz
14	PDB:4krcA	0.152	0.764	1.864E-17	297	0.043	0.229	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
15	PDB:2yaaA	0.156	0.759	1.966E-17	300	0.045	0.237	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
16	PDB:3c4wB	0.158	0.465	3.930E-17	519	0.044	0.133	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:4rerA	0.155	0.516	6.021E-17	459	0.054	0.185	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:1unlA	0.149	0.756	7.860E-17	292	0.041	0.223	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
19	PDB:4zhxA	0.150	0.550	1.204E-16	409	0.050	0.193	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:6byrA	0.148	0.552	1.413E-16	405	0.043	0.168	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9R0G8	0.0	1897	1455	0.642	0.698	NRK_MOUSE Nik-related protein kinase OS=Mus musculus OX=10090 GN=Nrk PE=1 SV=2
2	D3ZZQ0	8.64e-119	407	1260	0.119	0.150	D3ZZQ0_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=2
3	P83510	1.62e-118	407	1323	0.119	0.143	TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus OX=10090 GN=Tnik PE=1 SV=2
4	A0A8I5ZV95	2.44e-118	407	1305	0.119	0.145	A0A8I5ZV95_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
5	A0A8I6GLD8	2.98e-118	407	1352	0.119	0.140	A0A8I6GLD8_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
6	A0A8I5ZQ07	3.27e-118	407	1340	0.119	0.141	A0A8I5ZQ07_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
7	A0A0G2K490	3.55e-118	407	1360	0.119	0.139	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
8	Q9UKE5	3.55e-118	407	1360	0.119	0.139	TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK PE=1 SV=1
9	A0A8I6GFX7	1.28e-116	402	1318	0.116	0.139	A0A8I6GFX7_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
10	Q9JM52	8.83e-115	397	1308	0.121	0.147	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
11	Q8N4C8	1.92e-114	396	1332	0.121	0.144	MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1 PE=1 SV=2
12	F1LP90	1.66e-113	394	1336	0.121	0.143	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
13	Q7SY42	1.10e-112	390	1303	0.116	0.141	Q7SY42_DANRE TRAF2 and NCK interacting kinase a OS=Danio rerio OX=7955 GN=msn PE=1 SV=1
14	A0A0R4IEP9	1.63e-112	390	1332	0.116	0.138	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
15	Q7KV89	2.57e-110	379	1101	0.114	0.163	Q7KV89_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=2
16	Q7KV88	2.62e-110	379	1102	0.114	0.163	Q7KV88_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
17	M9PBJ7	1.37e-109	380	1213	0.114	0.149	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
18	Q7KV90	1.42e-109	379	1200	0.114	0.150	Q7KV90_DROME Misshapen, isoform B OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
19	M9PH19	2.86e-109	382	1404	0.114	0.128	M9PH19_DROME Misshapen, isoform F OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
20	O95819	6.94e-109	378	1239	0.119	0.152	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.54	20.9	ABC1 atypical kinase-like domain
2	PF00780 CNH	1.8e-36	137.9	CNH domain
3	PF06293 Kdo	56	14.6	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	2e-51	186.5	Protein kinase domain
5	PF17667 Pkinase_fungal	0.15	22.5	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	1.1e-38	144.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000434830

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247668	0.920	TNF receptor-associated factor 2
2	9606.ENSP00000382423	0.912	Mitogen-activated protein kinase kinase kinase 1
3	9606.ENSP00000398698	0.902	Tumor necrosis factor
4	9606.ENSP00000162749	0.900	Tumor necrosis factor receptor superfamily member 1A
5	9606.ENSP00000341268	0.900	Tumor necrosis factor receptor type 1-associated DEATH domain protein
6	9606.ENSP00000334140	0.720	Kelch domain-containing protein 10
7	9606.ENSP00000306968	0.628	Cell division cycle-associated protein 7
8	9606.ENSP00000248598	0.528	Fibroleukin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.989	protein serine/threonine kinase activity
GO:1901363	0.456	heterocyclic compound binding
GO:0097159	0.449	organic cyclic compound binding
GO:0019899	0.413	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0048583	0.940	regulation of response to stimulus
GO:0009987	0.936	cellular process
GO:0048518	0.927	positive regulation of biological process
GO:0023051	0.896	regulation of signaling
GO:0010646	0.896	regulation of cell communication
GO:0048522	0.864	positive regulation of cellular process
GO:0009966	0.848	regulation of signal transduction
GO:1902531	0.744	regulation of intracellular signal transduction
GO:0048584	0.739	positive regulation of response to stimulus
GO:0010647	0.721	positive regulation of cell communication
GO:0023056	0.712	positive regulation of signaling
GO:1902533	0.669	positive regulation of intracellular signal transduction
GO:0050896	0.623	response to stimulus
GO:0032501	0.615	multicellular organismal process
GO:0071704	0.614	organic substance metabolic process
GO:0043170	0.573	macromolecule metabolic process
GO:0043408	0.506	regulation of MAPK cascade
GO:0043410	0.501	positive regulation of MAPK cascade
GO:0023052	0.500	signaling
GO:0044238	0.492	primary metabolic process
GO:0051716	0.488	cellular response to stimulus
GO:0007154	0.472	cell communication
GO:0006807	0.470	nitrogen compound metabolic process
GO:0080134	0.468	regulation of response to stress
GO:0007165	0.455	signal transduction
GO:0060255	0.381	regulation of macromolecule metabolic process
GO:0042221	0.378	response to chemical
GO:0031323	0.367	regulation of cellular metabolic process
GO:0080090	0.362	regulation of primary metabolic process
GO:0051171	0.354	regulation of nitrogen compound metabolic process
GO:0065009	0.341	regulation of molecular function
GO:0019538	0.328	protein metabolic process
GO:0010033	0.324	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005634	0.952	nucleus
GO:0071944	0.932	cell periphery
GO:0005829	0.890	cytosol
GO:0016020	0.837	membrane
GO:0032991	0.586	protein-containing complex
GO:0005886	0.420	plasma membrane
GO:0031981	0.395	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]