StarFunc result for job id Q7Z2Y8

User Input

>input (2422 residues)
MATGEHTPDDPLLRGKRRQDLQEMLREVGLDVEYWLPKLQEHLGVTCAQALQHLDKNNLK
KLKSQTQHPWEKLLNLSHSKSLSALLQESQVERAKRKQKQAEQALQELRDLLTEGKQRQE
EAVRTREAELRQAMDIPEEYWPSPEEPLRELMENLQRQLNLMKWTLCHRQNLPDRDVVRW
ASGGLALQGIYKASHQRGLTEKREELLSVPKEFLLLGPQQGTQMKTKEFTSPQAEFMFTQ
MVEKLGFRLTTSAKDGNWGFSLEAGLDHSKHPESKETQQSSSENSYFCSTKFSYIPLASC
HFPIDQLQLSKPAVQELKCIEELLSQTTNPDRFSLLRHRIINFFHRFGSHVNQGPLHLGG
IYWWKAISEGYCTEQLAEVRQQSAEALDIFIRDSYSGFGVKVAAGVNVSDSHSKTATQTK
TSQNLQTKVQLSVAQTGGPPEADGLVQWKAGLIASNQTWCVIDRGLQLVPVWDIILSSHR
SNFKDPLQVANFLKDSYTALTSITAQIQNGEELLSAGKEARVFLEDVKSWEVSDPEEQLK
KLINFMKMLSQKLKSYDTWINICLTDSLQNFLVNTINFCKKSSIYKTKCIKSHLRSLLDP
HIYRVTNFPQAHFIMQWIFQSDSEQEQVNISQFSQLIEILKETQNNLMEVKVKSESPETV
EEAQRKSTYEVSLALSCFLNYLQKTEQTDTQLLLLSIAAAAGYHVINNTFQSLLGCDELS
FLLDEMQTAQNKYQELKNICSYRAQAFLVLTGLTATVGDTAISSEEKTQRMSLMRHHMGQ
SLSKEVAHVLTKPGADHDWENLEKDLRLLINGDYEEVTISSLQMEEVSKQSLFYGKKQPH
EPHDNENNKWEMIKNGAFLDLLQHLGLEHYYPKKLSKANFHLIYKTSVYNTQPSSEQELP
FYFLQKLLMMDYELRYLVFKDDRNTEHQVHPNASDQEDEAFDPYENFFEDSDSPTKSSST
EPSPHIHPVDIQMTIFHCADNFARQYILAKLSTCQFALPLLVPNPCTSQIEFSLWSLRQI
TRSWQEARKSPKGKNYYKNQQMCCVSTSIVSFVRVGNGLSASKSQIMNCLLSKRKHDVFF
HRHCTGSRKDCLLMGGMVEICWFCPGGEDEDRFDNCVTFTNLHGDAKEHEQQLSFLKEVS
TVIVVLMSASDDNEGNRKIVRNLWQSSRPLICLLDDKEATMTNISGQRMRMGIKNRNEAE
LTEELTTTIRHLLELSDTALSLEDCSQIAHQQGFLIDEDQRDCKEAKEKAQALMAFLGKM
KLSQIKEKLLPLQGQLWHHWCKKDKELYHLREKGNQSIEQHKSEIETDKQIIRHEQLARA
LPLNDLMQSVLQFLQEHSEIHTKLYFLQWLSVFLDKLTAGHLEELHEKQKYWWSLVQTVK
QKAPNSHSLICLQSEIEAISTEISDCTLGIEQLIREVGQIYEALEEASSIKKIFFSLPQI
AADLMISGVPIELMDGDAAYVPLTWVAAVFDKVSEKLGDKRLFVLSILGLQSSGKSTVLN
ALFGLQFTVSAGKCTQGAYMQLLKVEETFTEELGFDFVLAVDTEGLRAPEHSNKSKDRDN
ELVTFVIGLANLTLINIFGENPSEMQDILQIVVQAFLRMKQVKIFPSCLFVHQNVGEATA
TDQTMDGRRRLEQKLDEMAAIAAEQEQCLDVTCFSDVIRFDVNTHVYYFAHLWDGNPPMA
PPNPRYSHNVQQLKSRILMTATQESRGNIMKISDVKSRVQDLWRGLMNENFIFSFRNTQE
VMAMNKLETMYNHWTWELRSHVLGLQNQLINQIQNGKIQTLEASTFEVLVTEKYEVVKQE
LEKYFNEGPCSKILIQCKANFENKLIVLKEKLISDSKRQANELISFKNQSQERLNKKKTD
YEKELLEKSRKLALTVKGKELSEEELHEKFNQLWKKWVCDVSTTLPQVTEPDIDLDSENI
LWEYFKNKTNVVGLLTNSAEKFQINYDKHIKVNKKYNHIPMTLTVFEKEFINMTTDYIVS
RFNKIINNMWKQQCGYNPNYFHEILKTIEEEVKSASTQKRYTFTNTFIIDLCVCLFQRAR
ENFKEMHRAFKRANDPVNYLESKKDDFFTSFKISCQGATSIKTFVDVLWYKLTPAVSTTI
WEDMTFKIAGDMRATCPAFNGNRTNLEKHILFSLAEEENFDNYWEYLHNSKSFFRSYIKN
HIKRYCSDNGGEKMKTFFEKSLIDIKNTILSAIHESTSVAKDKSSTASEWLDLFCDCLGC
NLIFPRRDLISIEHQEIKHTEFLKEAMSAALDLTMKKIEQNYSSKPIEAMVSKIEKMLSE
HLCGCWKQCPSCGAICTNTIPTHEGDHSVPFHRPQAVNGEEWYETDDFVIDCCTSLVASD
CLLVLRDGRNFPFKNYRQAGGDYAMWSITPDTSIQLYWKWFVSHFRSNLEEKYQKKFAGK
GKIPNAWAKITKQDVLEDLKKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCY9	0.296	0.744	1.543E-49	931	0.095	0.246	Q8TCY9.pdb.gz	URGCP_HUMAN Up-regulator of cell proliferation OS=Homo sapiens OX=9606 GN=URGCP PE=1 SV=2
2	AFDB:Q9BX69	0.132	0.292	2.648E-15	1037	0.041	0.095	Q9BX69.pdb.gz	CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CARD6 PE=1 SV=2
3	AFDB:Q9FKE9	0.101	0.275	9.157E-11	834	0.041	0.120	Q9FKE9.pdb.gz	RHD32_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At5g45160 PE=2 SV=1
4	AFDB:P93042	0.098	0.277	2.134E-10	802	0.043	0.128	P93042.pdb.gz	RHD3_ARATH Protein ROOT HAIR DEFECTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=RHD3 PE=1 SV=1
5	AFDB:A0A509AN59	0.100	0.245	1.021E-9	913	0.055	0.145	A0A509AN59.pdb.gz	SEY1_PLABA Protein SEY1 homolog OS=Plasmodium berghei (strain Anka) OX=5823 GN=SEY1 PE=3 SV=1
6	AFDB:Q54W90	0.097	0.248	1.559E-9	894	0.050	0.134	Q54W90.pdb.gz	SEY1_DICDI Protein SEY1 homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_0206311 PE=3 SV=1
7	AFDB:A4QNT4	0.100	0.355	1.383E-7	618	0.026	0.100	A4QNT4.pdb.gz
8	PDB:6k1zA	0.097	0.336	5.115E-7	544	0.036	0.162	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.
9	AFDB:Q96PP8	0.110	0.365	5.134E-7	586	0.033	0.135	Q96PP8.pdb.gz	GBP5_HUMAN Guanylate-binding protein 5 OS=Homo sapiens OX=9606 GN=GBP5 PE=1 SV=1
10	AFDB:Q9ULX5	0.093	0.314	7.202E-7	631	0.024	0.092	Q9ULX5.pdb.gz	RN112_HUMAN RING finger protein 112 OS=Homo sapiens OX=9606 GN=RNF112 PE=1 SV=2
11	AFDB:Q8CFB4	0.099	0.364	8.899E-7	590	0.033	0.137	Q8CFB4.pdb.gz	GBP5_MOUSE Guanylate-binding protein 5 OS=Mus musculus OX=10090 GN=Gbp5 PE=1 SV=2
12	PDB:7pw4C	0.087	0.569	1.096E-6	310	0.019	0.148	7pw4C.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
13	PDB:6lojB	0.103	0.356	1.981E-6	571	0.039	0.165	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
14	PDB:7m1sA	0.101	0.360	2.347E-6	577	0.040	0.166	7m1sA.pdb.gz
15	PDB:6u2lA	0.079	0.280	3.046E-4	613	0.020	0.078	6u2lA.pdb.gz
16	PDB:6u23A	0.089	0.317	9.151E-4	583	0.021	0.087	6u23A.pdb.gz
17	PDB:7ua3A	0.062	0.044	1.284E-3	4443	0.092	0.050	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
18	PDB:3nsjA	0.082	0.305	1.339E-3	530	0.019	0.087	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
19	PDB:3zjcF	0.055	0.405	2.321E-3	252	0.018	0.175	3zjcF.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
20	PDB:3ojyB	0.081	0.313	2.526E-3	504	0.021	0.099	3ojyB.pdb.gz	Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TCY9	2.16e-78	283	931	0.103	0.267	URGCP_HUMAN Up-regulator of cell proliferation OS=Homo sapiens OX=9606 GN=URGCP PE=1 SV=2
2	Q9BX69	1.63e-13	79.3	1037	0.021	0.050	CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CARD6 PE=1 SV=2
3	Q54W90	1.71e-05	52.8	894	0.017	0.046	SEY1_DICDI Protein SEY1 homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_0206311 PE=3 SV=1
4	Q9FKE9	2.30e-05	52.4	834	0.017	0.048	RHD32_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At5g45160 PE=2 SV=1
5	P93042	0.002	45.8	802	0.019	0.056	RHD3_ARATH Protein ROOT HAIR DEFECTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=RHD3 PE=1 SV=1
6	Q9UTE0	0.015	43.1	762	0.014	0.043	SEY1_SCHPO Protein sey1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sey1 PE=1 SV=1
7	A0A509AN59	0.023	42.4	913	0.017	0.045	SEY1_PLABA Protein SEY1 homolog OS=Plasmodium berghei (strain Anka) OX=5823 GN=SEY1 PE=3 SV=1
8	Q99287	0.043	41.6	776	0.014	0.044	SEY1_YEAST Protein SEY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEY1 PE=1 SV=1
9	Q9C0L9	0.28	38.9	790	0.013	0.041	SEY1_CANAL Protein SEY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEY1 PE=1 SV=2
10	Q388F1	0.38	38.5	854	0.015	0.043	SEY1_TRYB2 Protein SEY1 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2200 PE=3 SV=1
11	Q922J3	1.1	37.0	1391	0.024	0.042	CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus OX=10090 GN=Clip1 PE=1 SV=1
12	Q500P4	1.8	35.8	338	0.013	0.092	Q500P4_PSEU2 Alginate regulatory protein AlgR3 OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=Psyr_0054 PE=4 SV=1
13	J9VP90	2.3	35.8	824	0.012	0.036	J9VP90_CRYNH Protein SEY1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=SEY1 PE=3 SV=2
14	B7ZAQ6	2.4	35.8	455	0.009	0.046	GPHRA_HUMAN Golgi pH regulator A OS=Homo sapiens OX=9606 GN=GPR89A PE=1 SV=2
15	P0CG08	2.4	35.8	455	0.009	0.046	GPHRB_HUMAN Golgi pH regulator B OS=Homo sapiens OX=9606 GN=GPR89B PE=1 SV=1
16	Q8LF21	2.4	35.8	614	0.022	0.088	DRP1C_ARATH Phragmoplastin DRP1C OS=Arabidopsis thaliana OX=3702 GN=DRP1C PE=1 SV=2
17	P34945	2.8	35.4	421	0.011	0.062	SYS_THET2 Serine--tRNA ligase OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=serS PE=1 SV=2
18	F4KG14	6.0	34.7	1082	0.013	0.029	F4KG14_ARATH Guanylate-binding family protein OS=Arabidopsis thaliana OX=3702 GN=GBPL3 PE=1 SV=1
19	Q5TIQ4	6.3	34.7	938	0.011	0.028	Q5TIQ4_ACETH 1,4-beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=celY PE=4 SV=1
20	F5HDM3	7.4	33.9	284	0.008	0.070	UL23_HCMVM Tegument protein UL23 OS=Human cytomegalovirus (strain Merlin) OX=295027 GN=UL23 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	1.5e+02	13.8	AAA domain
2	PF00350 Dynamin_N	1.6	20.2	Dynamin family
3	PF01926 MMR_HSR1	13	17.3	50S ribosome-binding GTPase
4	PF05879 RHD3_GTPase	0.026	25.4	Root hair defective 3 GTP-binding protein (RHD3) GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003819141.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003814512.1	0.648	Amyloid beta precursor protein binding protein 2
2	9597.XP_003811110.1	0.559	Amyloid beta precursor protein binding family A member 2
3	9597.XP_003811503.1	0.541	Guanine nucleotide-binding protein subunit alpha-14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016787	0.721	hydrolase activity
GO:0043167	0.639	ion binding
GO:0017111	0.621	ribonucleoside triphosphate phosphatase activity
GO:0043168	0.576	anion binding
GO:1901363	0.366	heterocyclic compound binding
GO:0097159	0.363	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0050896	0.926	response to stimulus
GO:0065007	0.806	biological regulation
GO:0050789	0.795	regulation of biological process
GO:0044419	0.508	biological process involved in interspecies interaction between organisms
GO:0009607	0.458	response to biotic stimulus
GO:0051707	0.451	response to other organism
GO:0051716	0.358	cellular response to stimulus
GO:0006950	0.355	response to stress
GO:0050794	0.344	regulation of cellular process
GO:0006952	0.300	defense response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.969	organelle
GO:0005829	0.960	cytosol
GO:0043227	0.954	membrane-bounded organelle
GO:0043229	0.880	intracellular organelle
GO:0043231	0.854	intracellular membrane-bounded organelle
GO:0005634	0.555	nucleus
GO:0032991	0.408	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.721	Hydrolases.
RHEA:23680	0.621	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.621	nucleoside-triphosphate phosphatase.

[back to server]