StarFunc result for job id Q7Z2Z1

User Input

>input (1910 residues)
MACCHKVMLLLDTAGGAARHSRVRRAALRLLTYLSCRFGLARVHWAFKFFDSQGARSRPS
RVSDFRELGSRSWEDFEEELEARLEDRAHLPGPAPRATHTHGALMETLLDYQWDRPEITS
PTKPILRSSGRRLLDVESEAKEAEAALGGLVNAVFLLAPCPHSQRELLQFVSGCEAQAQR
LPPTPKQVMEKLLPKRVREVMVARKITFYWVDTTEWSKLWESPDHLGYWTVCELLHHGGG
TVLPSESFSWDFAQAGEMLLRSGIKLSSEPHLSPWISMLPTDATLNRLLYNSPEYEASFP
RMEGMLFLPVEAGKEIQETWTVTLEPLAMHQRHFQKPVRIFLKGSVAQWSLPTSSTLGTD
SWMLGSPEESTATQRLLFQQLVSRLTAEELHLVADVDPGEGRPPITGVISPLSASAMILT
VCRTKEAEFQRHVLQTAVADSPRDTASLFSDVVDSILNQTHDSLADTASAASPVPEWAQQ
ELGHTTPWSPAVVEKWFPFCNISGASSDLMESFGLLQAASANKEESSKTEGELIHCLAEL
YQRKSREESTIAHQEDSKKKRGVPRTPVRQKMNTMCRSLKMLNVARLNVKAQKLHPDGSP
DVAGEKGIQKIPSGRTVDKLEDRGRTLRSSKPKDFKTEEELLSYIRENYQKTVATGEIML
YACARNMISTVKMFLKSKGTKELEVNCLNQVKSSLLKTSKSLRQNLGKKLDKEDKVRECQ
LQVFLRLEMCLQCPSINESTDDMEQVVEEVTDLLRMVCLTEDSAYLAEFLEEILRLYIDS
IPKTLGNLYNSLGFVIPQKLAGVLPTDFFSDDSMTQENKSPLLSVPFLSSARRSVSGSPE
SDELQELRTRSAKKRRKNALIRHKSIAEVSQNLRQIEIPKVSKRATKKENSHPAPQQPSQ
PVKDTVQEVTKVRRNLFNQELLSPSKRSLKRGLPRSHSVSAVDGLEDKLDNFKKNKGYHK
LLTKSVAETPVHKQISKRLLHRQIKGRSSDPGPDIGVVEESPEKGDEISLRRSPRIKQLS
FSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPS
EKGSARMKKRSRNTLDSEVPAAYQTPKKSHQKSLSFSKTTPRRISHTPQTPLYTPERLQK
SPAKMTPTKQAAFKESLKDSSSPGHDSPLDSKITPQKRHTQAGEGTSLETKTPRTPKRQG
TQPPGFLPNCTWPHSVNSSPESPSCPAPPTSSTAQPRRECLTPIRDPLRTPPRAAAFMGT
PQNQTHQQPHVLRAARAEEPAQKLKDKAIKTPKRPGNSTVTSSPPVTPKKLFTSPLCDVS
KKSPFRKSKIECPSPGELDQKEPQMSPSVAASLSCPVPSTPPELSQRATLDTVPPPPPSK
VGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGY
PGPGLRSDWHASSPLLITSDTEHVTLLSEAEHHGIGDLKSNVLSVEEGEGLRTADAEKSS
LSHPGIPPSPPSCGPGSPLMPSRDVHCTTDGRQCQASAQLDNLPASAWHSTDSASPQTYE
VELEMQASGLPKLRIKKIDPSSSLEAEPLSKEESSLGEESFLPALSMPRASRSLSKPEPT
YVSPPCPRLSHSTPGKSRGQTYICQACTPTHGPSSTPSPFQTDGVPWTPSPKHSGKTTPD
IIKDWPRRKRAVGCGAGSSSGRGEVGADLPGSLSLLESEGKDHGLELSIHRTPILEDFEL
EGVCQLPDQSPPRNSMPKAEEASSWGQFGLSSRKRVLLAKEEADRGAKRICDLREDSEVS
KSKEGSPSWSAWQLPSTGDEEVFVSGSTPPPSCAVRSCLSASALQALTQSPLLFQGKTPS
SQSKDPRDEDVDVLPSTVEDSPFSRAFSRRRPISRTYTRKKLMGTWLEDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z2Z1	1.000	1.000	0.000	1910	1.000	1.000	Q7Z2Z1.pdb.gz	TICRR_HUMAN Treslin OS=Homo sapiens OX=9606 GN=TICRR PE=1 SV=2
2	AFDB:D3IUT5	0.248	0.240	2.993E-86	1985	0.381	0.367	D3IUT5.pdb.gz	TICRR_XENLA Treslin OS=Xenopus laevis OX=8355 GN=ticrr PE=1 SV=1
3	AFDB:Q6DRL4	0.304	0.314	5.999E-76	1824	0.307	0.322	Q6DRL4.pdb.gz	TICRR_DANRE Treslin OS=Danio rerio OX=7955 GN=ticrr PE=2 SV=1
4	AFDB:Q54LJ4	0.100	0.080	2.283E-8	2563	0.120	0.090	Q54LJ4.pdb.gz	Q54LJ4_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286613 PE=3 SV=1
5	PDB:5y58B	0.086	0.190	3.962E-8	568	0.031	0.104	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
6	PDB:6zheC	0.087	0.181	4.820E-8	705	0.047	0.128	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
7	PDB:7nfcC	0.082	0.211	3.776E-7	477	0.027	0.109	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
8	PDB:5y58A	0.118	0.305	4.824E-7	548	0.033	0.115	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
9	PDB:7k0yC	0.093	0.195	9.581E-7	655	0.032	0.095	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
10	PDB:1jeqA	0.110	0.277	5.875E-6	548	0.033	0.115	1jeqA.pdb.gz
11	PDB:6sn1A	0.086	0.206	3.973E-5	517	0.035	0.130	6sn1A.pdb.gz
12	AFDB:Q5T5P2	0.035	0.034	4.329E-5	1943	0.103	0.101	Q5T5P2.pdb.gz	SKT_HUMAN Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2
13	AFDB:A2AQ25	0.039	0.038	5.266E-5	1946	0.103	0.101	A2AQ25.pdb.gz	SKT_MOUSE Sickle tail protein OS=Mus musculus OX=10090 GN=Skt PE=1 SV=1
14	AFDB:Q9NPG3	0.039	0.053	3.229E-4	1134	0.076	0.128	Q9NPG3.pdb.gz	UBN1_HUMAN Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2
15	AFDB:Q4G0F8	0.037	0.049	9.037E-4	1135	0.081	0.136	Q4G0F8.pdb.gz	UBN1_MOUSE Ubinuclein-1 OS=Mus musculus OX=10090 GN=Ubn1 PE=2 SV=1
16	AFDB:Q6ZU65	0.044	0.055	1.099E-3	1347	0.091	0.129	Q6ZU65.pdb.gz	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
17	PDB:2xwbF	0.075	0.164	1.354E-3	714	0.020	0.053	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
18	AFDB:Q8TEK3	0.048	0.054	1.980E-3	1537	0.131	0.163	Q8TEK3.pdb.gz	DOT1L_HUMAN Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Homo sapiens OX=9606 GN=DOT1L PE=1 SV=3
19	PDB:1m2vA	0.090	0.217	2.105E-3	705	0.024	0.064	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
20	PDB:6zgaA	0.066	0.150	4.390E-3	751	0.022	0.056	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3IUT5	0.0	807	1985	0.274	0.263	TICRR_XENLA Treslin OS=Xenopus laevis OX=8355 GN=ticrr PE=1 SV=1
2	Q7Z2Z1	0.0	3887	1910	1.000	1.000	TICRR_HUMAN Treslin OS=Homo sapiens OX=9606 GN=TICRR PE=1 SV=2
3	Q6DRL4	2.00e-168	564	1824	0.216	0.226	TICRR_DANRE Treslin OS=Danio rerio OX=7955 GN=ticrr PE=2 SV=1
4	O67198	0.48	37.7	439	0.031	0.134	O67198_AQUAE Transcriptional regulator (NtrC family) OS=Aquifex aeolicus (strain VF5) OX=224324 GN=ntrC1 PE=1 SV=1
5	Q385R6	3.9	35.0	1706	0.024	0.027	Q385R6_TRYB2 E3 ubiquitin-protein ligase listerin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2670 PE=3 SV=1
6	M9PC48	4.4	35.0	18095	0.055	0.006	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	Q9H714	6.1	34.3	662	0.017	0.048	PACER_HUMAN Protein associated with UVRAG as autophagy enhancer OS=Homo sapiens OX=9606 GN=RUBCNL PE=1 SV=3
8	M9PCJ6	6.8	34.3	18641	0.055	0.006	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15292 Treslin_N	0	1275.3	Treslin N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268138

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260810	0.997	DNA topoisomerase 2-binding protein 1
2	9606.ENSP00000405726	0.996	Cell division control protein 45 homolog
3	9606.ENSP00000303398	0.985	Mdm2-binding protein
4	9606.ENSP00000265056	0.958	DNA replication licensing factor MCM2
5	9606.ENSP00000418268	0.933	Protein MCM10 homolog
6	9606.ENSP00000301019	0.909	DNA replication factor Cdt1
7	9606.ENSP00000388648	0.903	Serine/threonine-protein kinase Chk1
8	9606.ENSP00000265728	0.901	Protein DBF4 homolog A
9	9606.ENSP00000209728	0.894	Cell division control protein 6 homolog
10	9606.ENSP00000378704	0.891	Bromodomain-containing protein 2
11	9606.ENSP00000482313	0.887	ATP-dependent DNA helicase Q4
12	9606.ENSP00000393139	0.827	Cell division cycle 7-related protein kinase
13	9606.ENSP00000406164	0.814	Geminin coiled-coil domain-containing protein 1
14	9606.ENSP00000262105	0.810	DNA replication licensing factor MCM4
15	9606.ENSP00000357643	0.808	Proliferation marker protein Ki-67
16	9606.ENSP00000274026	0.806	Cyclin-A2
17	9606.ENSP00000323663	0.796	Protein DBF4 homolog B
18	9606.ENSP00000307288	0.779	DNA replication licensing factor MCM7
19	9606.ENSP00000302530	0.766	Mitotic checkpoint serine/threonine-protein kinase BUB1
20	9606.ENSP00000479598	0.745	RAD9, HUS1, RAD1-interacting nuclear orphan protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0019219	0.977	regulation of nucleobase-containing compound metabolic process
GO:0051052	0.960	regulation of DNA metabolic process
GO:0006275	0.937	regulation of DNA replication
GO:0090329	0.856	regulation of DNA-templated DNA replication
GO:0009987	0.805	cellular process
GO:0030174	0.676	regulation of DNA-templated DNA replication initiation
GO:0071704	0.496	organic substance metabolic process
GO:0044238	0.490	primary metabolic process
GO:0044237	0.490	cellular metabolic process
GO:0006807	0.460	nitrogen compound metabolic process
GO:0050896	0.406	response to stimulus
GO:0043170	0.403	macromolecule metabolic process
GO:0007049	0.356	cell cycle
GO:0051716	0.315	cellular response to stimulus
GO:0048519	0.304	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.949	intracellular non-membrane-bounded organelle
GO:0005694	0.746	chromosome
GO:0098687	0.715	chromosomal region
GO:0032991	0.674	protein-containing complex
GO:0000775	0.444	chromosome, centromeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]