StarFunc result for job id Q7Z2Z2

User Input

>input (1120 residues)
MVLNSLDKMIQLQKNTANIRNICVLAHVDHGKTTLADCLISSNGIISSRLAGKLRYMDSR
EDEQIRGITMKSSAISLHYATGNEEYLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAV
EGVCPQTQAVLRQAWLENIRPVLVINKIDRLIVELKFTPQEAYSHLKNILEQINALTGTL
FTSKVLEERAERETESQVNPNSEQGEQVYDWSTGLEDTDDSHLYFSPEQGNVVFTSAIDG
WGFGIEHFARIYSQKIGIKKEVLMKTLWGDYYINMKAKKIMKGDQAKGKKPLFVQLILEN
IWSLYDAVLKKDKDKIDKIVTSLGLKIGAREARHSDPKVQINAICSQWLPISHAVLAMVC
QKLPSPLDITAERVERLMCTGSQTFDSFPPETQALKAAFMKCGSEDTAPVIIFVSKMFAV
DAKALPQNKPRPLTQEEIAQRRERARQRHAEKLAAAQGQAPLEPTQDGSAIETCPKGEEP
RGDEQQVESMTPKPVLQEENNQESFIAFARVFSGVARRGKKIFVLGPKYSPLEFLRRVPL
GFSAPPDGLPQVPHMAYCALENLYLLMGRELEYLEEVPPGNVLGIGGLQDFVLKSATLCS
LPSCPPFIPLNFEATPIVRVAVEPKHPSEMPQLVKGMKLLNQADPCVQILIQETGEHVLV
TAGEVHLQRCLDDLKERFAKIHISVSEPIIPFRETITKPPKVDMVNEEIGKQQKVAVIHQ
MKEDQSKIPEGIQVDSDGLITITTPNKLATLSVRAMPLPEEVTQILEENSDLIRSMEQLT
SSLNEGENTHMIHQKTQEKIWEFKGKLEQHLTGRRWRNIVDQIWSFGPRKCGPNILVNKS
EDFQNSVWTGPADKASKEASRYRDLGNSIVSGFQLATLSGPMCEEPLMGVCFVLEKWDLS
KFEEQGASDLAKEGQEENETCSGGNENQELQDGCSEAFEKRTSQKGESPLTDCYGPFSGQ
LIATMKEACRYALQVKPQRLMAAMYTCDIMATGDVLGRVYAVLSKREGRVLQEEMKEGTD
MFIIKAVLPVAESFGFADEIRKRTSGLASPQLVFSHWEIIPSDPFWVPTTEEEYLHFGEK
ADSENQARKYMNAVRKRKGLYVEEKIVEHAEKQRTLSKNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5anbK	0.728	0.728	0.000	1120	1.000	1.000	5anbK.pdb.gz	Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
2	AFDB:O74945	0.763	0.850	0.000	1000	0.403	0.451	O74945.pdb.gz	RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ria1 PE=3 SV=1
3	AFDB:P53893	0.765	0.772	0.000	1110	0.401	0.405	P53893.pdb.gz	RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIA1 PE=1 SV=1
4	AFDB:Q54WF2	0.734	0.707	0.000	1164	0.424	0.408	Q54WF2.pdb.gz	Q54WF2_DICDI Elongation factor Tu domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=eftud1 PE=4 SV=1
5	AFDB:Q7Z2Z2	1.000	1.000	0.000	1120	1.000	1.000	Q7Z2Z2.pdb.gz	EFL1_HUMAN Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1 PE=1 SV=2
6	AFDB:Q9VV61	0.836	0.904	0.000	1033	0.452	0.490	Q9VV61.pdb.gz	Q9VV61_DROME Tr-type G domain-containing protein OS=Drosophila melanogaster OX=7227 GN=CG10162 PE=1 SV=3
7	AFDB:Q582T0	0.695	0.866	4.016E-91	890	0.298	0.375	Q582T0.pdb.gz	Q582T0_TRYB2 Translation elongation factor EF-2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.820 PE=4 SV=1
8	AFDB:C0H9N2	0.635	0.815	5.135E-84	858	0.280	0.366	C0H9N2.pdb.gz	C0H9N2_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
9	AFDB:Q54JV1	0.638	0.824	5.868E-83	853	0.289	0.380	Q54JV1.pdb.gz	Q54JV1_DICDI Elongation factor 2 OS=Dictyostelium discoideum OX=44689 GN=cinC PE=4 SV=1
10	AFDB:A0A286Y8X9	0.646	0.829	8.502E-83	860	0.280	0.365	A0A286Y8X9.pdb.gz
11	AFDB:P15112	0.644	0.843	8.964E-83	839	0.285	0.380	P15112.pdb.gz	EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum OX=44689 GN=efbA PE=1 SV=2
12	PDB:7dvqC	0.637	0.779	7.692E-70	902	0.241	0.299	7dvqC.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:6d9j9	0.518	0.655	7.127E-67	856	0.288	0.377	6d9j9.pdb.gz	Dual tRNA mimicry in the Cricket Paralysis Virus IRES uncovers an unexpected similarity with the Hepatitis C Virus IRES.
14	PDB:3jb9B	0.616	0.750	9.288E-67	904	0.226	0.280	3jb9B.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
15	PDB:6j6gC	0.618	0.740	2.842E-60	920	0.205	0.250	6j6gC.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
16	PDB:5juoDC	0.532	0.678	1.468E-59	841	0.277	0.369	5juoDC.pdb.gz	Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
17	PDB:5lj3C	0.596	0.744	5.841E-55	882	0.199	0.253	5lj3C.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
18	PDB:3dnyT	0.396	0.641	1.830E-51	654	0.212	0.362	3dnyT.pdb.gz
19	PDB:7nshBC	0.336	0.510	5.090E-35	700	0.144	0.230	7nshBC.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
20	PDB:7cdwA	0.324	0.485	9.134E-33	683	0.130	0.214	7cdwA.pdb.gz	Crystal Structure of Mycobacterium tuberculosis Elongation Factor G1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O74945	0.0	825	1000	0.412	0.462	RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ria1 PE=3 SV=1
2	Q54WF2	0.0	588	1164	0.311	0.299	Q54WF2_DICDI Elongation factor Tu domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=eftud1 PE=4 SV=1
3	Q7Z2Z2	0.0	2324	1120	1.000	1.000	EFL1_HUMAN Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1 PE=1 SV=2
4	Q95TH3	0.0	852	949	0.413	0.488	Q95TH3_DROME SD04694p OS=Drosophila melanogaster OX=7227 GN=CG4638 PE=2 SV=1
5	Q9VV61	0.0	958	1033	0.458	0.497	Q9VV61_DROME Tr-type G domain-containing protein OS=Drosophila melanogaster OX=7227 GN=CG10162 PE=1 SV=3
6	P53893	2.08e-120	400	1110	0.195	0.196	RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIA1 PE=1 SV=1
7	Q54JV1	1.51e-84	295	853	0.150	0.197	Q54JV1_DICDI Elongation factor 2 OS=Dictyostelium discoideum OX=44689 GN=cinC PE=4 SV=1
8	P15112	7.01e-83	290	839	0.144	0.192	EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum OX=44689 GN=efbA PE=1 SV=2
9	Q5A0M4	1.52e-78	278	842	0.146	0.194	EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EFT2 PE=1 SV=2
10	Q582T0	1.10e-77	276	890	0.151	0.190	Q582T0_TRYB2 Translation elongation factor EF-2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.820 PE=4 SV=1
11	Q6FYA7	1.61e-77	275	842	0.145	0.192	EF2_CANGA Elongation factor 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EFT1 PE=3 SV=1
12	Q38BE4	3.26e-76	271	846	0.142	0.188	Q38BE4_TRYB2 Elongation factor 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2650 PE=4 SV=1
13	P32324	4.00e-76	271	842	0.144	0.191	EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFT1 PE=1 SV=1
14	P29691	1.61e-74	266	852	0.142	0.187	EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans OX=6239 GN=eef-2 PE=1 SV=4
15	O14460	4.81e-74	265	842	0.138	0.184	EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eft201 PE=1 SV=2
16	C0H9N2	6.27e-71	256	858	0.136	0.177	C0H9N2_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
17	Q9ASR1	4.77e-70	253	843	0.139	0.185	EF2_ARATH Elongation factor 2 OS=Arabidopsis thaliana OX=3702 GN=LOS1 PE=1 SV=1
18	C0HAQ6	6.72e-70	253	858	0.136	0.177	C0HAQ6_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
19	P58252	1.51e-69	252	858	0.158	0.206	EF2_MOUSE Elongation factor 2 OS=Mus musculus OX=10090 GN=Eef2 PE=1 SV=2
20	P05197	1.69e-69	252	858	0.158	0.206	EF2_RAT Elongation factor 2 OS=Rattus norvegicus OX=10116 GN=Eef2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00679 EFG_C	6.7e-14	63.0	Elongation factor G C-terminus
2	PF14492 EFG_III	0.00015	33.0	Elongation Factor G, domain III
3	PF03764 EFG_IV	3.9	18.7	Elongation factor G, domain IV
4	PF00009 GTP_EFTU	1.5e-58	209.1	Elongation factor Tu GTP binding domain
5	PF03144 GTP_EFTU_D2	0.099	24.4	Elongation factor Tu domain 2
6	PF01926 MMR_HSR1	56	15.3	50S ribosome-binding GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268206

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246868	0.999	Ribosome maturation protein SBDS
2	9606.ENSP00000363574	0.932	Eukaryotic translation initiation factor 6
3	9606.ENSP00000311430	0.888	L ribosomal proteins
4	9606.ENSP00000331901	0.865	Elongation factor 1-gamma
5	9606.ENSP00000364320	0.856	mRNA turnover protein 4 homolog
6	9606.ENSP00000359345	0.855	60S ribosomal protein L5
7	9606.ENSP00000260443	0.849	Probable ribosome biogenesis protein RLP24
8	9606.ENSP00000363676	0.840	60S ribosomal protein L11
9	9606.ENSP00000278572	0.825	40S ribosomal protein S3
10	9606.ENSP00000389103	0.825	60S ribosomal protein L23a
11	9606.ENSP00000400467	0.823	L ribosomal proteins
12	9606.ENSP00000435370	0.822	Ubiquitin-like protein FUBI
13	9606.ENSP00000467466	0.820	Ribosomal protein S15
14	9606.ENSP00000393241	0.819	40S ribosomal protein S18
15	9606.ENSP00000420311	0.819	Ribosomal protein L23
16	9606.ENSP00000270625	0.806	Ribosomal protein S11
17	9606.ENSP00000259469	0.797	60S ribosomal protein L35
18	9606.ENSP00000419004	0.790	60S ribosomal export protein NMD3
19	9606.ENSP00000265245	0.774	Large subunit GTPase 1 homolog
20	9606.ENSP00000371451	0.752	DnaJ homolog subfamily C member 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043022	0.998	ribosome binding
GO:0003924	0.998	GTPase activity
GO:0005515	0.994	protein binding
GO:0097159	0.927	organic cyclic compound binding
GO:1901363	0.926	heterocyclic compound binding
GO:0003676	0.918	nucleic acid binding
GO:0003723	0.650	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:1901564	0.989	organonitrogen compound metabolic process
GO:0034641	0.964	cellular nitrogen compound metabolic process
GO:0022613	0.921	ribonucleoprotein complex biogenesis
GO:0042254	0.914	ribosome biogenesis
GO:0006139	0.898	nucleobase-containing compound metabolic process
GO:0070925	0.892	organelle assembly
GO:0009259	0.849	ribonucleotide metabolic process
GO:0006163	0.830	purine nucleotide metabolic process
GO:0140694	0.760	non-membrane-bounded organelle assembly
GO:0009199	0.725	ribonucleoside triphosphate metabolic process
GO:0009144	0.725	purine nucleoside triphosphate metabolic process
GO:0009150	0.717	purine ribonucleotide metabolic process
GO:0009205	0.713	purine ribonucleoside triphosphate metabolic process
GO:0043170	0.618	macromolecule metabolic process
GO:0010467	0.506	gene expression
GO:0042255	0.391	ribosome assembly
GO:0050789	0.327	regulation of biological process
GO:0009058	0.325	biosynthetic process
GO:1901576	0.324	organic substance biosynthetic process
GO:0044271	0.317	cellular nitrogen compound biosynthetic process
GO:0050794	0.309	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0070013	0.941	intracellular organelle lumen
GO:0005634	0.806	nucleus
GO:0043232	0.411	intracellular non-membrane-bounded organelle
GO:0005654	0.343	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.998	GTP + H2O = GDP + H(+) + phosphate

[back to server]