StarFunc result for job id Q7Z309

User Input

>input (247 residues)
MAQEKMELDLEPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLRTRRNSTTIMSRHSLE
EGLDMVNRETAHEREMQTAMQISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSP
TRGFGKMFVSSSGLPPSPVPSPRRFSRRSQSPVKCIRPSVLGPLKRKGEMETESQPKRLF
QGTTNMLSPDAAQLSDLSSCSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFIL
MDDLSPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R982	0.121	0.107	4.007E-2	289	0.215	0.183	F1R982.pdb.gz
2	AFDB:P49710	0.160	0.086	4.607E-2	486	0.150	0.076	P49710.pdb.gz	HCLS1_MOUSE Hematopoietic lineage cell-specific protein OS=Mus musculus OX=10090 GN=Hcls1 PE=1 SV=2
3	AFDB:Q54XS3	0.128	0.024	8.052E-2	1661	0.130	0.019	Q54XS3.pdb.gz	GDT1_DICDI Probable inactive serine/threonine-protein kinase gdt1 OS=Dictyostelium discoideum OX=44689 GN=gdt1 PE=1 SV=1
4	AFDB:Q76P38	0.133	0.088	1.065E-1	398	0.126	0.078	Q76P38.pdb.gz	Q76P38_DICDI Lis-interacting protein OS=Dictyostelium discoideum OX=44689 GN=nudE PE=3 SV=1
5	AFDB:A0A0B6VLS4	0.119	0.035	1.407E-1	1152	0.142	0.030	A0A0B6VLS4.pdb.gz
6	AFDB:A0A0G2JYE6	0.126	0.104	1.618E-1	307	0.166	0.134	A0A0G2JYE6.pdb.gz	A0A0G2JYE6_RAT Paired-like homeobox 2b OS=Rattus norvegicus OX=10116 GN=Phox2b PE=4 SV=2
7	AFDB:Q9D0P7	0.123	0.096	1.735E-1	329	0.239	0.179	Q9D0P7.pdb.gz	PSRC1_MOUSE Proline/serine-rich coiled-coil protein 1 OS=Mus musculus OX=10090 GN=Psrc1 PE=1 SV=2
8	AFDB:P32243	0.115	0.103	1.861E-1	289	0.174	0.149	P32243.pdb.gz	OTX2_HUMAN Homeobox protein OTX2 OS=Homo sapiens OX=9606 GN=OTX2 PE=1 SV=1
9	AFDB:Q96GW7	0.095	0.037	1.995E-1	911	0.182	0.049	Q96GW7.pdb.gz	PGCB_HUMAN Brevican core protein OS=Homo sapiens OX=9606 GN=BCAN PE=1 SV=2
10	AFDB:Q9MAC8	0.142	0.052	1.995E-1	792	0.186	0.058	Q9MAC8.pdb.gz	SSY2_ARATH Starch synthase 2, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=SS2 PE=1 SV=1
11	PDB:3jd5a	0.079	0.070	6.377	289	0.036	0.031	3jd5a.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
12	PDB:7b5lP	0.084	0.180	7.862	77	0.053	0.169	7b5lP.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
13	PDB:3jb9h	0.066	0.127	8.430	90	0.040	0.111	3jb9h.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96E09	4.61e-84	254	287	0.700	0.603	PBIR1_HUMAN PPP2R1A-PPP2R2A-interacting phosphatase regulator 1 OS=Homo sapiens OX=9606 GN=PABIR1 PE=1 SV=1
2	Q6P4D5	9.18e-20	85.9	195	0.211	0.267	PBIR3_HUMAN PABIR family member 1 OS=Homo sapiens OX=9606 GN=PABIR3 PE=1 SV=1
3	Q9EPM5	0.48	33.9	470	0.085	0.045	SYNCI_MOUSE Syncoilin OS=Mus musculus OX=10090 GN=Sync PE=1 SV=1
4	Q7KVA1	0.56	33.9	876	0.085	0.024	XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster OX=7227 GN=oxt PE=2 SV=1
5	Q61092	0.77	33.5	1191	0.126	0.026	LAMC2_MOUSE Laminin subunit gamma-2 OS=Mus musculus OX=10090 GN=Lamc2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002487

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004772	0.862	Phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
2	61853.ENSNLEP00000015098	0.691	Amyloid beta (A4) precursor protein-binding, family A, member 2
3	61853.ENSNLEP00000016057	0.637	SLIT and NTRK-like family, member 2
4	61853.ENSNLEP00000002450	0.608	Placenta-specific 1
5	61853.ENSNLEP00000014711	0.549	CAP, adenylate cyclase-associated protein 1 (yeast)
6	61853.ENSNLEP00000011997	0.520	Ras and Rab interactor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004865	0.999	protein serine/threonine phosphatase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048518	0.990	positive regulation of biological process
GO:0009987	0.988	cellular process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0080090	0.970	regulation of primary metabolic process
GO:0048523	0.956	negative regulation of cellular process
GO:0007346	0.954	regulation of mitotic cell cycle
GO:0010564	0.951	regulation of cell cycle process
GO:0048522	0.948	positive regulation of cellular process
GO:0051246	0.931	regulation of protein metabolic process
GO:0051173	0.929	positive regulation of nitrogen compound metabolic process
GO:0045930	0.927	negative regulation of mitotic cell cycle
GO:1901987	0.917	regulation of cell cycle phase transition
GO:1901990	0.905	regulation of mitotic cell cycle phase transition
GO:1901988	0.905	negative regulation of cell cycle phase transition
GO:0031325	0.858	positive regulation of cellular metabolic process
GO:1901991	0.816	negative regulation of mitotic cell cycle phase transition
GO:0010604	0.735	positive regulation of macromolecule metabolic process
GO:0050896	0.732	response to stimulus
GO:0051716	0.699	cellular response to stimulus
GO:0051128	0.624	regulation of cellular component organization
GO:0009894	0.611	regulation of catabolic process
GO:0042176	0.597	regulation of protein catabolic process
GO:0007165	0.593	signal transduction
GO:0031329	0.566	regulation of cellular catabolic process
GO:0051247	0.566	positive regulation of protein metabolic process
GO:0035556	0.553	intracellular signal transduction
GO:1903050	0.552	regulation of proteolysis involved in protein catabolic process
GO:2000058	0.541	regulation of ubiquitin-dependent protein catabolic process
GO:1903047	0.499	mitotic cell cycle process
GO:0000075	0.457	cell cycle checkpoint signaling
GO:0007093	0.440	mitotic cell cycle checkpoint signaling
GO:0032434	0.425	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0009896	0.418	positive regulation of catabolic process
GO:0045732	0.409	positive regulation of protein catabolic process
GO:0045862	0.396	positive regulation of proteolysis
GO:1902749	0.385	regulation of cell cycle G2/M phase transition
GO:0010389	0.336	regulation of G2/M transition of mitotic cell cycle
GO:1903052	0.336	positive regulation of proteolysis involved in protein catabolic process
GO:0010972	0.314	negative regulation of G2/M transition of mitotic cell cycle
GO:1901800	0.306	positive regulation of proteasomal protein catabolic process
GO:2000060	0.306	positive regulation of ubiquitin-dependent protein catabolic process
GO:0032436	0.301	positive regulation of proteasomal ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.541	cytosol
GO:0005654	0.450	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]