StarFunc result for job id Q7Z333

User Input

>input (2677 residues)
MSTCCWCTPGGASTIDFLKRYASNTPSGEFQTADEDLCYCLECVAEYHKARDELPFLHEV
LWELETLRLINHFEKSMKAEIGDDDELYIVDNNGEMPLFDITGQDFENKLRVPLLEILKY
PYLLLHERVNELCVEALCRMEQANCSFQVFDKHPGIYLFLVHPNEMVRRWAILTARNLGK
VDRDDYYDLQEVLLCLFKVIELGLLESPDIYTSSVLEKGKLILLPSHMYDTTNYKSYWLG
ICMLLTILEEQAMDSLLLGSDKQNDFMQSILHTMEREADDDSVDPFWPALHCFMVILDRL
GSKVWGQLMDPIVAFQTIINNASYNREIRHIRNSSVRTKLEPESYLDDMVTCSQIVYNYN
PEKTKKDSGWRTAICPDYCPNMYEEMETLASVLQSDIGQDMRVHNSTFLWFIPFVQSLMD
LKDLGVAYIAQVVNHLYSEVKEVLNQTDAVCDKVTEFFLLILVSVIELHRNKKCLHLLWV
SSQQWVEAVVKCAKLPTTAFTRSSEKSSGNCSKGTAMISSLSLHSMPSNSVQLAYVQLIR
SLLKEGYQLGQQSLCKRFWDKLNLFLRGNLSLGWQLTSQETHELQSCLKQIIRNIKFKAP
PCNTFVDLTSACKISPASYNKEESEQMGKTSRKDMHCLEASSPTFSKEPMKVQDSVLIKA
DNTIEGDNNEQNYIKDVKLEDHLLAGSCLKQSSKNIFTERAEDQIKISTRKQKSVKEISS
YTPKDCTSRNGPERGCDRGIIVSTRLLTDSSTDALEKVSTSNEDFSLKDDALAKTSKRKT
KVQKDEICAKLSHVIKKQHRKSTLVDNTINLDENLTVSNIESFYSRKDTGVQKGDGFIHN
LSLDPSGVLDDKNGEQKSQNNVLPKEKQLKNEELVIFSFHENNCKIQEFHVDGKELIPFT
EMTNASEKKSSPFKDLMTVPESRDEEMSNSTSVIYSNLTREQAPDISPKSDTLTDSQIDR
DLHKLSLLAQASVITFPSDSPQNSSQLQRKVKEDKRCFTANQNNVGDTSRGQVIIISDSD
DDDDERILSLEKLTKQDKICLEREHPEQHVSTVNSKEEKNPVKEEKTETLFQFEESDSQC
FEFESSSEVFSVWQDHPDDNNSVQDGEKKCLAPIANTTNGQGCTDYVSEVVKKGAEGIEE
HTRPRSISVEEFCEIEVKKPKRKRSEKPMAEDPVRPSSSVRNEGQSDTNKRDLVGNDFKS
IDRRTSTPNSRIQRATTVSQKKSSKLCTCTEPIRKVPVSKTPKKTHSDAKKGQNRSSNYL
SCRTTPAIVPPKKFRQCPEPTSTAEKLGLKKGPRKAYELSQRSLDYVAQLRDHGKTVGVV
DTRKKTKLISPQNLSVRNNKKLLTSQELQMQRQIRPKSQKNRRRLSDCESTDVKRAGSHT
AQNSDIFVPESDRSDYNCTGGTEVLANSNRKQLIKCMPSEPETIKAKHGSPATDDACPLN
QCDSVVLNGTVPTNEVIVSTSEDPLGGGDPTARHIEMAALKEGEPDSSSDAEEDNLFLTQ
NDPEDMDLCSQMENDNYKLIELIHGKDTVEVEEDSVSRPQLESLSGTKCKYKDCLETTKN
QGEYCPKHSEVKAADEDVFRKPGLPPPASKPLRPTTKIFSSKSTSRIAGLSKSLETSSAL
SPSLKNKSKGIQSILKVPQPVPLIAQKPVGEMKNSCNVLHPQSPNNSNRQGCKVPFGESK
YFPSSSPVNILLSSQSVSDTFVKEVLKWKYEMFLNFGQCGPPASLCQSISRPVPVRFHNY
GDYFNVFFPLMVLNTFETVAQEWLNSPNRENFYQLQVRKFPADYIKYWEFAVYLEECELA
KQLYPKENDLVFLAPERINEEKKDTERNDIQDLHEYHSGYVHKFRRTSVMRNGKTECYLS
IQTQENFPANLNELVNCIVISSLVTTQRKLKAMSLLGSRNQLARAVLNPNPMDFCTKDLL
TTTSERIIAYLRDFNEDQKKAIETAYAMVKHSPSVAKICLIHGPPGTGKSKTIVGLLYRL
LTENQRKGHSDENSNAKIKQNRVLVCAPSNAAVDELMKKIILEFKEKCKDKKNPLGNCGD
INLVRLGPEKSINSEVLKFSLDSQVNHRMKKELPSHVQAMHKRKEFLDYQLDELSRQRAL
CRGGREIQRQELDENISKVSKERQELASKIKEVQGRPQKTQSIIILESHIICCTLSTSGG
LLLESAFRGQGGVPFSCVIVDEAGQSCEIETLTPLIHRCNKLILVGDPKQLPPTVISMKA
QEYGYDQSMMARFCRLLEENVEHNMISRLPILQLTVQYRMHPDICLFPSNYVYNRNLKTN
RQTEAIRCSSDWPFQPYLVFDVGDGSERRDNDSYINVQEIKLVMEIIKLIKDKRKDVSFR
NIGIITHYKAQKTMIQKDLDKEFDRKGPAEVDTVDAFQGRQKDCVIVTCVRANSIQGSIG
FLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNQLIQDAQKRGAIIKTCDKNYRHDAV
KILKLKPVLQRSLTHPPTIAPEGSRPQGGLPSSKLDSGFAKTSVAASLYHTPSDSKEITL
TVTSKDPERPPVHDQLQDPRLLKRMGIEVKGGIFLWDPQPSSPQHPGATPPTGEPGFPVV
HQDLSHIQQPAAVVAALSSHKPPVRGEPPAASPEASTCQSKCDDPEEELCHRREARAFSE
GEQEKCGSETHHTRRNSRWDKRTLEQEDSSSKKRKLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AKX3	0.425	0.429	0.000	2646	0.719	0.728	A2AKX3.pdb.gz	SETX_MOUSE Probable helicase senataxin OS=Mus musculus OX=10090 GN=Setx PE=1 SV=1
2	AFDB:Q7Z333	1.000	1.000	0.000	2677	1.000	1.000	Q7Z333.pdb.gz	SETX_HUMAN Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4
3	PDB:5eanA	0.170	0.404	1.872E-26	1051	0.061	0.156	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
4	PDB:4pj3A	0.206	0.392	2.235E-24	1335	0.056	0.112	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
5	PDB:3jb9X	0.188	0.392	8.294E-15	1195	0.040	0.090	3jb9X.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
6	AFDB:P42694	0.173	0.232	8.688E-13	1942	0.066	0.091	P42694.pdb.gz	HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2
7	AFDB:Q6DFV5	0.177	0.236	6.194E-12	1964	0.070	0.095	Q6DFV5.pdb.gz	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
8	PDB:4cejA	0.097	0.204	2.939E-6	1177	0.040	0.092	4cejA.pdb.gz	Structural Basis for Translocation by Addab Helicase-Nuclease and its Arrest at Chi Sites.
9	PDB:5ld2D	0.102	0.376	8.548E-6	605	0.031	0.136	5ld2D.pdb.gz	Mechanism for nuclease regulation in RecBCD.
10	PDB:3k70D	0.092	0.358	9.716E-6	547	0.030	0.148	3k70D.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.
11	PDB:3u44A	0.093	0.201	1.153E-5	1122	0.043	0.102	3u44A.pdb.gz	Insights into Chi recognition from the structure of an AddAB-type helicase-nuclease complex.
12	PDB:2is6A	0.099	0.357	1.310E-5	654	0.033	0.136	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
13	PDB:2is4B	0.100	0.373	2.949E-5	632	0.030	0.128	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
14	PDB:3ex7C	0.099	0.511	4.150E-5	392	0.020	0.138	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
15	AFDB:P46100	0.079	0.083	6.076E-5	2492	0.095	0.102	P46100.pdb.gz	ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=6
16	AFDB:Q61687	0.107	0.114	1.153E-4	2476	0.099	0.107	Q61687.pdb.gz	ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus OX=10090 GN=Atrx PE=1 SV=3
17	AFDB:O95996	0.066	0.073	1.203E-4	2303	0.093	0.109	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
18	AFDB:Q57ZA6	0.078	0.112	5.364E-4	1572	0.072	0.123	Q57ZA6.pdb.gz	Q57ZA6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1020 PE=4 SV=1
19	AFDB:O76743	0.092	0.181	6.640E-4	1156	0.065	0.151	O76743.pdb.gz	GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2
20	AFDB:Q22308	0.102	0.233	1.773E-3	1022	0.058	0.152	Q22308.pdb.gz	Q22308_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-19 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AKX3	0.0	3739	2646	0.719	0.728	SETX_MOUSE Probable helicase senataxin OS=Mus musculus OX=10090 GN=Setx PE=1 SV=1
2	Q7Z333	0.0	5564	2677	1.000	1.000	SETX_HUMAN Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4
3	Q92355	5.99e-70	264	1687	0.072	0.114	SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sen1 PE=1 SV=1
4	Q00416	9.61e-69	261	2231	0.084	0.101	SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEN1 PE=1 SV=2
5	O94387	2.05e-65	250	1944	0.066	0.091	YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A10.10c PE=3 SV=1
6	F4I5Z7	1.12e-63	244	2114	0.095	0.120	F4I5Z7_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g16800 PE=1 SV=2
7	O64476	2.41e-58	224	1090	0.084	0.206	O64476_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g19120 PE=1 SV=1
8	Q9SZW3	1.37e-56	220	1311	0.082	0.167	Q9SZW3_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g30100 PE=1 SV=1
9	P30771	7.40e-53	206	971	0.062	0.170	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1
10	B6SFA4	5.81e-51	198	818	0.046	0.149	MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana OX=3702 GN=MAA3 PE=2 SV=1
11	Q9FJR0	5.22e-48	192	1254	0.079	0.169	RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana OX=3702 GN=UPF1 PE=1 SV=2
12	Q9VYS3	1.50e-46	187	1180	0.058	0.132	RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster OX=7227 GN=Upf1 PE=1 SV=2
13	Q09820	2.32e-46	185	925	0.059	0.171	RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf1 PE=3 SV=2
14	Q582F1	4.30e-46	183	842	0.053	0.169	Q582F1_TRYB2 Regulator of nonsense transcripts 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.50 PE=3 SV=1
15	Q9EPU0	7.37e-46	184	1124	0.062	0.149	RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus OX=10090 GN=Upf1 PE=1 SV=2
16	A0A024R7L5	1.90e-45	183	1118	0.062	0.148	A0A024R7L5_HUMAN UPF1 OS=Homo sapiens OX=9606 GN=UPF1 PE=2 SV=1
17	F1RCY6	2.95e-45	182	1100	0.062	0.150	RENT1_DANRE Regulator of nonsense transcripts 1 OS=Danio rerio OX=7955 GN=upf1 PE=2 SV=1
18	Q92900	3.00e-45	182	1129	0.062	0.147	RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2
19	O76512	5.14e-43	175	1069	0.061	0.152	RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans OX=6239 GN=smg-2 PE=1 SV=1
20	O94247	1.07e-36	152	660	0.066	0.267	HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hcs1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13086 AAA_11	9.2e-65	230.6	AAA domain
2	PF13087 AAA_12	8.3e-49	177.4	AAA domain
3	PF13191 AAA_16	1.6	20.5	AAA ATPase domain
4	PF13245 AAA_19	8.6e-05	34.3	AAA domain
5	PF13401 AAA_22	0.021	26.5	AAA domain
6	PF13604 AAA_30	0.00012	33.3	AAA domain
7	PF09848 DUF2075	23	15.7	Schlafen group 3, DNA/RNA helicase domain
8	PF05127 Helicase_RecD	26	16.1	Helicase
9	PF04851 ResIII	0.48	21.9	Type III restriction enzyme, res subunit
10	PF00580 UvrD-helicase	0.16	23.1	UvrD/REP helicase N-terminal domain
11	PF01443 Viral_helicase1	0.19	23.0	Viral (Superfamily 1) RNA helicase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000224140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418960	0.995	Breast cancer type 1 susceptibility protein
2	9606.ENSP00000480158	0.991	DNA-directed RNA polymerase II subunit RPB1
3	9606.ENSP00000305480	0.985	Flap endonuclease 1
4	9606.ENSP00000368984	0.966	Exosome complex component RRP45
5	9606.ENSP00000413098	0.929	Protein SCAF8
6	9606.ENSP00000366396	0.927	5'-3' exoribonuclease 2
7	9606.ENSP00000286835	0.912	Splicing factor, arginine/serine-rich 15
8	9606.ENSP00000366135	0.895	Exosome component 10
9	9606.ENSP00000298281	0.893	Pre-mRNA cleavage complex 2 protein Pcf11
10	9606.ENSP00000470252	0.859	Transcription elongation factor SPT5
11	9606.ENSP00000282516	0.853	Nipped-B-like protein
12	9606.ENSP00000346890	0.851	Nardilysin
13	9606.ENSP00000264276	0.841	Alsin
14	9606.ENSP00000291386	0.829	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
15	9606.ENSP00000284995	0.817	tRNA-splicing endonuclease subunit Sen2
16	9606.ENSP00000225504	0.815	Transcription elongation factor SPT4
17	9606.ENSP00000230640	0.810	Superkiller viralicidic activity 2-like 2
18	9606.ENSP00000366843	0.809	Ataxin-2
19	9606.ENSP00000417175	0.809	Vesicle-associated membrane protein-associated protein B/C
20	9606.ENSP00000238112	0.805	Cleavage and polyadenylation specificity factor subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140640	0.998	catalytic activity, acting on a nucleic acid
GO:0003676	0.998	nucleic acid binding
GO:0140657	0.995	ATP-dependent activity
GO:0140097	0.988	catalytic activity, acting on DNA
GO:0004386	0.988	helicase activity
GO:0003677	0.988	DNA binding
GO:0003678	0.981	DNA helicase activity
GO:0043565	0.921	sequence-specific DNA binding
GO:0003690	0.918	double-stranded DNA binding
GO:1990837	0.897	sequence-specific double-stranded DNA binding
GO:0000976	0.893	transcription cis-regulatory region binding
GO:0001147	0.879	transcription termination site sequence-specific DNA binding
GO:0042802	0.873	identical protein binding
GO:0003723	0.371	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0043170	0.981	macromolecule metabolic process
GO:0090304	0.971	nucleic acid metabolic process
GO:0050794	0.968	regulation of cellular process
GO:0010467	0.951	gene expression
GO:0016070	0.950	RNA metabolic process
GO:0034654	0.909	nucleobase-containing compound biosynthetic process
GO:0032774	0.888	RNA biosynthetic process
GO:0006351	0.866	DNA-templated transcription
GO:0060255	0.846	regulation of macromolecule metabolic process
GO:0050896	0.806	response to stimulus
GO:0044260	0.799	cellular macromolecule metabolic process
GO:0006353	0.795	DNA-templated transcription termination
GO:0051171	0.756	regulation of nitrogen compound metabolic process
GO:0080090	0.749	regulation of primary metabolic process
GO:0031323	0.749	regulation of cellular metabolic process
GO:0019219	0.738	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.715	positive regulation of cellular process
GO:0071840	0.680	cellular component organization or biogenesis
GO:0006950	0.677	response to stress
GO:0051716	0.671	cellular response to stimulus
GO:0010468	0.668	regulation of gene expression
GO:0016043	0.645	cellular component organization
GO:0009893	0.641	positive regulation of metabolic process
GO:0010604	0.615	positive regulation of macromolecule metabolic process
GO:0033554	0.602	cellular response to stress
GO:0009889	0.539	regulation of biosynthetic process
GO:0006396	0.516	RNA processing
GO:0010556	0.502	regulation of macromolecule biosynthetic process
GO:0051173	0.497	positive regulation of nitrogen compound metabolic process
GO:0031325	0.489	positive regulation of cellular metabolic process
GO:0048519	0.478	negative regulation of biological process
GO:0031326	0.367	regulation of cellular biosynthetic process
GO:0048523	0.342	negative regulation of cellular process
GO:0051252	0.337	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005694	0.996	chromosome
GO:0016604	0.990	nuclear body
GO:0030426	0.975	growth cone
GO:0005737	0.949	cytoplasm
GO:0045171	0.916	intercellular bridge
GO:0000228	0.915	nuclear chromosome
GO:0032991	0.870	protein-containing complex
GO:0005829	0.326	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]