StarFunc result for job id Q7Z340

User Input

>input (670 residues)
MPAPVGRRSPPSPRSSMAAVALRDSAQGMTFEDVAIYFSQEEWELLDESQRFLYCDVMLE
NFAHVTSLGYCHGMENEAIASEQSVSIQVRTSKGNTPTQKTHLSEIKMCVPVLKDILPAA
EHQTTSPVQKSYLGSTSMRGFCFSADLHQHQKHYNEEEPWKRKVDEATFVTGCRFHVLNY
FTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFNAKSYYKWGEYRKASSHKHTLVQ
HQSVCSEGGLYECSKCEKAFTCKNTLVQHQQIHTGQKMFECSECEESFSKKCHLILHKII
HTGERPYECSDREKAFIHKSEFIHHQRRHTGGVRHECGECRKTFSYKSNLIEHQRVHTGE
RPYECGECGKSFRQSSSLFRHQRVHSGERPYQCCECGKSFRQIFNLIRHRRVHTGEMPYQ
CSDCGKSFSCKSELIQHQRIHSGERPYECRECGKSFRQFSNLIRHRSIHTGDRPYECSEC
EKSFSRKFILIQHQRVHTGERPYECSECGKSFTRKSDLIQHRRIHTGTRPYECSECGKSF
RQRSGLIQHRRLHTGERPYECSECGKSFSQSASLIQHQRVHTGERPYECSECGKSFSQSS
SLIQHQRGHTGERPYECSQCGKPFTHKSDLIQHQRVHTGERPYECSECGKSFSRKSNLIR
HRRVHTEERP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TF45	0.373	0.370	3.218E-61	676	0.504	0.500	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
2	AFDB:Q06732	0.429	0.376	4.574E-59	778	0.455	0.392	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
3	AFDB:Q9HCX3	0.547	0.555	2.303E-58	659	0.506	0.514	Q9HCX3.pdb.gz	ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens OX=9606 GN=ZNF304 PE=1 SV=2
4	AFDB:Q14587	0.471	0.348	5.755E-58	947	0.436	0.308	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
5	AFDB:Q9BX82	0.505	0.538	2.601E-57	626	0.421	0.450	Q9BX82.pdb.gz	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
6	AFDB:Q62788	0.391	0.357	2.127E-56	744	0.401	0.362	Q62788.pdb.gz	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
7	AFDB:A0A024R4S7	0.475	0.408	5.609E-56	792	0.416	0.352	A0A024R4S7.pdb.gz
8	AFDB:A2AWF2	0.487	0.477	8.179E-56	685	0.407	0.399	A2AWF2.pdb.gz	A2AWF2_MOUSE Reduced expression 2 OS=Mus musculus OX=10090 GN=Rex2 PE=1 SV=1
9	AFDB:A2A9J5	0.411	0.425	1.015E-55	645	0.399	0.414	A2A9J5.pdb.gz	A2A9J5_MOUSE Zinc finger protein 980 OS=Mus musculus OX=10090 GN=Zfp980 PE=4 SV=1
10	AFDB:Q5MCW4	0.466	0.457	1.835E-55	686	0.419	0.410	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
11	PDB:3w5kB	0.078	0.277	4.578E-4	110	0.054	0.327	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4fjcE	0.067	0.091	3.276E-1	434	0.055	0.085	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	PDB:7uhyC	0.045	0.051	6.599E-1	578	0.024	0.028	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:6vp9B	0.094	0.077	9.118E-1	914	0.076	0.056	6vp9B.pdb.gz	Molecular basis for N-terminal alpha-synuclein acetylation by human NatB.
15	PDB:7ena4	0.070	0.089	9.118E-1	457	0.051	0.074	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:7o4i1	0.057	0.068	9.623E-1	522	0.061	0.079	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
17	PDB:6ydhA	0.032	0.163	1.016	62	0.027	0.290	6ydhA.pdb.gz
18	PDB:4btsA9	0.030	0.153	1.260	93	0.033	0.237	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
19	PDB:7pe9I	0.047	0.079	1.329	317	0.046	0.098	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
20	PDB:5dkaA	0.046	0.234	1.403	96	0.018	0.125	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17021	0.0	619	662	0.496	0.502	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
2	P51523	0.0	534	738	0.436	0.396	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
3	P52742	0.0	538	658	0.445	0.453	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
4	Q5MCW4	0.0	551	686	0.443	0.433	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
5	Q6ECI4	0.0	564	717	0.449	0.420	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
6	Q6P9A3	0.0	576	640	0.463	0.484	ZN549_HUMAN Zinc finger protein 549 OS=Homo sapiens OX=9606 GN=ZNF549 PE=1 SV=2
7	Q7TMN8	0.0	529	578	0.412	0.478	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
8	Q8BFS8	0.0	580	652	0.485	0.498	ZN418_MOUSE Zinc finger protein 418 OS=Mus musculus OX=10090 GN=ZNF418 PE=2 SV=1
9	Q8QZZ2	0.0	580	635	0.478	0.504	Q8QZZ2_MOUSE Zinc finger protein 418 OS=Mus musculus OX=10090 GN=Zfp418 PE=2 SV=1
10	Q8TAQ5	0.0	565	688	0.460	0.448	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
11	Q8TF45	0.0	631	676	0.521	0.516	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
12	Q9HCX3	0.0	630	659	0.515	0.524	ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens OX=9606 GN=ZNF304 PE=1 SV=2
13	Q9Y2P7	0.0	623	627	0.518	0.553	ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens OX=9606 GN=ZNF256 PE=1 SV=2
14	Q8BLA2	1.02e-180	527	578	0.410	0.476	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
15	Q9BX82	3.28e-180	528	626	0.434	0.465	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
16	P15620	8.25e-177	517	580	0.379	0.438	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
17	P17020	1.24e-175	518	682	0.427	0.419	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
18	Q14587	3.28e-175	526	947	0.439	0.310	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
19	Q14585	3.24e-174	507	488	0.363	0.498	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
20	O75290	1.10e-173	511	641	0.412	0.431	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	1.1	20.9	TFIIH C1-like domain
2	PF03604 DNA_RNApol_7kD	4.1e+02	12.1	DNA directed RNA polymerase, 7 kDa subunit
3	PF01352 KRAB	5.7e-20	82.0	KRAB box
4	PF10484 MRP-S23	24	16.6	Mitochondrial ribosomal protein S23
5	PF00096 zf-C2H2	4.2e-78	264.8	Zinc finger, C2H2 type
6	PF13894 zf-C2H2_4	2.2e-44	157.2	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	1.2e-25	100.1	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	0.058	24.9	Zinc-finger double-stranded RNA-binding
9	PF13465 zf-H2C2_2	1.4e-110	368.5	Zinc-finger double domain
10	PF12874 zf-met	0.0053	28.3	Zinc-finger of C2H2 type
11	PF18439 zf_UBZ	0.044	24.7	Ubiquitin-Binding Zinc Finger
12	PF17032 zinc_ribbon_15	1.9	20.6	zinc-ribbon family
13	PF09723 Zn-ribbon_8	0.034	25.6	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282296

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315081	0.661	Leucine rich single-pass membrane protein 2
2	9606.ENSP00000376419	0.641	Kelch-like protein 23
3	9606.ENSP00000378427	0.556	UPF0461 protein C5orf24
4	9606.ENSP00000462799	0.529	TBC1 domain family member 29

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0019219	0.915	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.903	regulation of macromolecule metabolic process
GO:2001141	0.875	regulation of RNA biosynthetic process
GO:0006355	0.873	regulation of DNA-templated transcription
GO:0048519	0.799	negative regulation of biological process
GO:0048523	0.658	negative regulation of cellular process
GO:0009987	0.570	cellular process
GO:0010605	0.490	negative regulation of macromolecule metabolic process
GO:0031324	0.490	negative regulation of cellular metabolic process
GO:0051172	0.489	negative regulation of nitrogen compound metabolic process
GO:0045934	0.469	negative regulation of nucleobase-containing compound metabolic process
GO:0050896	0.415	response to stimulus
GO:1902679	0.368	negative regulation of RNA biosynthetic process
GO:1903507	0.355	negative regulation of nucleic acid-templated transcription
GO:0045892	0.354	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.976	intracellular organelle lumen
GO:0005654	0.945	nucleoplasm
GO:0016020	0.774	membrane
GO:0005737	0.659	cytoplasm
GO:0043232	0.364	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]