StarFunc result for job id Q7Z353

User Input

>input (690 residues)
MNLRSVFTVEQQRILQRYYENGMTNQSKNCFQLILQCAQETKLDFSVVRTWVGNKRRKMS
SKNSESGTATTGTSLSAPDITVRNVVNIARPSSQQSSWTSANNDVIVTGIYSPASSSSRQ
GTNKHTDTQITEAHKIPIQKTATKNDTEFQLHIPVQRQVAHCKNASLLLGEKTIILSRQT
SVLNAGNSVFNHAKKNYGNSSVQASEMTVPQKPSVCHRPCKIEPVGIQRSYKPEHTGPAL
HNLCGQKPTIRDPYCRTQNLEIREVFSLAVSDYPQRILGGNAPQKPSSAEGNCLSIAMET
GDAEDEYAREEELASMRAQIPSYSRFYESGSSLRAENQSTTLPGPGRNMPNSQMVNIRDM
SDNVLYQNRNYHLTPRTSLHTASSTMYSNTNPLRSNFSPHFASSNQLRLSQNQNNYQISG
NLTVPWITGCSRKRALQDRTQFSDRDLATLKKYWDNGMTSLGSVCREKIEAVATELNVDC
EIVRTWIGNRRRKYRLMGIEVPPPRGGPADFSEQPESGSLSALTPGEEAGPEVGEDNDRN
DEVSICLSEGSSQEEPNEVVPNDARAHKEEDHHAVTTDNVKIEIIDDEESDMISNSEVEQ
VNSFLDYKNEEVKFIENELEIQKQKYFKLQTFVRSLILAMKADDKEQQQALLSDLPPELE
EMDFNHASLEPDDTSFSVSSLSEKNVSESL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z353	1.000	1.000	2.482E-92	690	1.000	1.000	Q7Z353.pdb.gz	HDX_HUMAN Highly divergent homeobox OS=Homo sapiens OX=9606 GN=HDX PE=1 SV=1
2	AFDB:P06601	0.090	0.101	1.192E-3	613	0.109	0.122	P06601.pdb.gz	PRD_DROME Segmentation protein paired OS=Drosophila melanogaster OX=7227 GN=prd PE=1 SV=1
3	AFDB:Q9VA38	0.064	0.047	1.192E-3	1105	0.158	0.099	Q9VA38.pdb.gz	WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster OX=7227 GN=wts PE=1 SV=1
4	AFDB:P0CH95	0.057	0.045	1.149E-2	1032	0.117	0.078	P0CH95.pdb.gz	PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio OX=7955 GN=phf8 PE=1 SV=1
5	AFDB:Q9UPP1	0.057	0.041	1.450E-2	1060	0.110	0.072	Q9UPP1.pdb.gz	PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=3
6	AFDB:Q5VWG9	0.081	0.063	2.747E-2	929	0.142	0.105	Q5VWG9.pdb.gz	TAF3_HUMAN Transcription initiation factor TFIID subunit 3 OS=Homo sapiens OX=9606 GN=TAF3 PE=1 SV=1
7	AFDB:Q54XP9	0.072	0.040	2.911E-2	1297	0.122	0.065	Q54XP9.pdb.gz	Q54XP9_DICDI Centrosomal protein 148 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278809 PE=4 SV=1
8	AFDB:P20823	0.074	0.080	3.085E-2	631	0.094	0.103	P20823.pdb.gz	HNF1A_HUMAN Hepatocyte nuclear factor 1-alpha OS=Homo sapiens OX=9606 GN=HNF1A PE=1 SV=2
9	AFDB:Q1X8D7	0.076	0.071	5.204E-2	754	0.136	0.125	Q1X8D7.pdb.gz	LRC36_HUMAN Leucine-rich repeat-containing protein 36 OS=Homo sapiens OX=9606 GN=LRRC36 PE=1 SV=2
10	AFDB:Q99246	0.079	0.035	8.283E-2	2179	0.129	0.041	Q99246.pdb.gz	CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus OX=10090 GN=Cacna1d PE=1 SV=3
11	PDB:2hi3A	0.081	0.613	1.018E-1	73	0.016	0.151	2hi3A.pdb.gz
12	PDB:4egcA	0.072	0.091	5.818E-1	539	0.014	0.019	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7fbyA	0.064	0.237	1.391	153	0.017	0.078	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:2vbwA	0.058	0.229	1.754	147	0.017	0.082	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
15	PDB:2cg4A	0.059	0.212	2.088	149	0.017	0.081	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:6gejS	0.048	0.142	2.346	208	0.020	0.067	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:2cyyA	0.066	0.258	2.635	151	0.009	0.040	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
18	PDB:5nr5A	0.072	0.363	2.635	113	0.033	0.204	5nr5A.pdb.gz
19	PDB:3ispA	0.061	0.127	3.324	290	0.023	0.055	3ispA.pdb.gz
20	PDB:4v8mAU	0.062	0.329	4.710	85	0.014	0.118	4v8mAU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z353	0.0	1440	690	1.000	1.000	HDX_HUMAN Highly divergent homeobox OS=Homo sapiens OX=9606 GN=HDX PE=1 SV=1
2	A0A1C7CYV8	0.005	42.7	611	0.032	0.036	A0A1C7CYV8_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
3	A0A1C7CYY7	0.005	42.4	577	0.032	0.038	A0A1C7CYY7_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
4	P56223	0.005	42.0	301	0.032	0.073	PO6F1_RAT POU domain, class 6, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou6f1 PE=2 SV=1
5	Q5U4D4	0.005	42.7	576	0.032	0.038	Q5U4D4_MOUSE POU domain protein OS=Mus musculus OX=10090 GN=Pou6f1 PE=1 SV=1
6	Q07916	0.006	41.6	301	0.032	0.073	PO6F1_MOUSE POU domain, class 6, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou6f1 PE=1 SV=1
7	Q14863	0.008	41.2	301	0.032	0.073	PO6F1_HUMAN POU domain, class 6, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
8	P31367	0.009	41.6	610	0.032	0.036	PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio OX=7955 GN=pou6f1 PE=2 SV=1
9	P14859	0.031	40.0	743	0.033	0.031	PO2F1_HUMAN POU domain, class 2, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU2F1 PE=1 SV=2
10	A0A0A0MT46	0.045	39.3	594	0.033	0.039	A0A0A0MT46_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F1 PE=1 SV=1
11	A0A0C4DG88	0.048	39.3	561	0.033	0.041	A0A0C4DG88_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F1 PE=1 SV=1
12	Q04787	0.091	38.1	429	0.036	0.058	BSH_DROME Brain-specific homeobox protein OS=Drosophila melanogaster OX=7227 GN=bsh PE=2 SV=5
13	Q7T103	0.16	37.4	449	0.033	0.051	P5F11_XENLA POU domain, class 5, transcription factor 1.1 OS=Xenopus laevis OX=8355 GN=pou5f1.1 PE=1 SV=1
14	P78424	0.30	37.0	691	0.028	0.027	PO6F2_HUMAN POU domain, class 6, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU6F2 PE=1 SV=3
15	A0A0R4J6S2	0.33	36.6	694	0.028	0.027	A0A0R4J6S2_DANRE POU domain protein OS=Danio rerio OX=7955 GN=pou6f2 PE=3 SV=1
16	P15143	0.36	36.6	739	0.030	0.028	PO2F1_CHICK POU domain, class 2, transcription factor 1 OS=Gallus gallus OX=9031 GN=POU2F1 PE=2 SV=1
17	Q3C1V8	0.36	35.8	233	0.033	0.099	BSH_HUMAN Brain-specific homeobox protein homolog OS=Homo sapiens OX=9606 GN=BSX PE=2 SV=2
18	Q810B3	0.36	35.8	232	0.033	0.099	BSH_MOUSE Brain-specific homeobox protein homolog OS=Mus musculus OX=10090 GN=Bsx PE=1 SV=1
19	Q9UKI9	0.55	35.8	436	0.046	0.073	PO2F3_HUMAN POU domain, class 2, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=3
20	O57602	0.69	35.4	623	0.019	0.021	O57602_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	8.5e-08	43.2	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297977

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000443410	0.673	Putative nucleotidyltransferase FAM46D
2	9606.ENSP00000322570	0.632	DNA polymerase epsilon catalytic subunit A
3	9606.ENSP00000262752	0.559	Ribosomal protein S6 kinase alpha-6
4	9606.ENSP00000297866	0.559	Cilia- and flagella-associated protein 47
5	9606.ENSP00000350049	0.517	Homeobox and leucine zipper protein Homez
6	9606.ENSP00000323455	0.516	Tetra-peptide repeat homeobox protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.957	heterocyclic compound binding
GO:0097159	0.957	organic cyclic compound binding
GO:0003677	0.952	DNA binding
GO:0043565	0.551	sequence-specific DNA binding
GO:0140110	0.532	transcription regulator activity
GO:0003700	0.502	DNA-binding transcription factor activity
GO:0003690	0.336	double-stranded DNA binding
GO:1990837	0.317	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.989	regulation of DNA-templated transcription
GO:0009987	0.843	cellular process
GO:0048518	0.716	positive regulation of biological process
GO:0032501	0.708	multicellular organismal process
GO:0032502	0.699	developmental process
GO:0048856	0.690	anatomical structure development
GO:0048523	0.675	negative regulation of cellular process
GO:0048522	0.675	positive regulation of cellular process
GO:0010558	0.629	negative regulation of macromolecule biosynthetic process
GO:0051253	0.561	negative regulation of RNA metabolic process
GO:1902679	0.495	negative regulation of RNA biosynthetic process
GO:0007275	0.449	multicellular organism development
GO:0051173	0.431	positive regulation of nitrogen compound metabolic process
GO:0048731	0.424	system development
GO:0045935	0.402	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.349	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0043232	0.865	intracellular non-membrane-bounded organelle
GO:0005737	0.824	cytoplasm
GO:0005886	0.651	plasma membrane
GO:0005829	0.406	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]