StarFunc result for job id Q7Z392

User Input

>input (1133 residues)
MSPTQWDFPVELCCRPMAFVTLTGLDVVYNAVHRAVWDAFCANRRADRVPISFKVLPGDH
EYPKCRPKRTSYEWYIPKGILKTGWMNKHLNLVPALVVVFYELDWDEPQWKEKQSECATR
VEIVRQSLQGRNTKVAVVLIQKKTPLPPGEDVIASERAAALCNACELSGKSLFVLPHTDH
LVGYIIRLENAFYEHAQTYYYTEIRRVKSHKEFLNKTTHQLLFVRHQFKIAFFSELKQDT
QNALKNYRTAYNLVHELRAHETNILEIKTMAGFINYKICRLCFQHNTPLDAIAQFRKHID
LCKKKIGSAELSFEHDAWMSKQFQAFGDLFDEAIKLGLTAIQTQNPGFYYQQAAYYAQER
KQLAKTLCNHEASVMYPNPDPLETQTGVLDFYGQRSWRQGILSFDLSDPEKEKVGILAIQ
LKERNVVHSEIIITLLSNAVAQFKKYKCPRMKSHLMVQMGEEYYYAKDYTKALKLLDYVM
CDYRSEGWWTLLTSVLTTALKCSYLMAQLKDYITYSLELLGRASTLKDDQKSRIEKNLIN
VLMNESPDPEPDCDILAVKTAQKLWADRISLAGSNIFTIGVQDFVPFVQCKAKFHAPSFH
VDVPVQFDIYLKADCPHPIRFSKLCVSFNNQEYNQFCVIEEASKANEVLENLTQGKMCLV
PGKTRKLLFKFVAKTEDVGKKIEITSVDLALGNETGRCVVLNWQGGGGDAASSQEALQAA
RSFKRRPKLPDNEVHWDSIIIQASTMIISRVPNISVHLLHEPPALTNEMYCLVVTVQSHE
KTQIRDVKLTAGLKPGQDANLTQKTHVTLHGTELCDESYPALLTDIPVGDLHPGEQLEKM
LYVRCGTVGSRMFLVYVSYLINTTVEEKEIVCKCHKDETVTIETVFPFDVAVKFVSTKFE
HLERVYADIPFLLMTDLLSASPWALTIVSSELQLAPSMTTVDQLESQVDNVILQTGESAS
ECFCLQCPSLGNIEGGVATGHYIISWKRTSAMENIPIITTVITLPHVIVENIPLHVNADL
PSFGRVRESLPVKYHLQNKTDLVQDVEISVEPSDAFMFSGLKQIRLRILPGTEQEMLYNF
YPLMAGYQQLPSLNINLLRFPNFTNQLLRRFIPTSIFVKPQGRLMDDTSIAAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1RLX4	0.762	0.762	0.000	1132	0.784	0.784	Q1RLX4.pdb.gz	TPC11_DANRE Trafficking protein particle complex subunit 11 OS=Danio rerio OX=7955 GN=trappc11 PE=2 SV=1
2	AFDB:Q7Z392	1.000	1.000	0.000	1133	1.000	1.000	Q7Z392.pdb.gz	TPC11_HUMAN Trafficking protein particle complex subunit 11 OS=Homo sapiens OX=9606 GN=TRAPPC11 PE=1 SV=2
3	AFDB:Q8IRE3	0.607	0.528	3.000E-84	1320	0.309	0.265	Q8IRE3.pdb.gz	Q8IRE3_DROME Trafficking protein particle complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=gry PE=1 SV=2
4	AFDB:F4JXM9	0.535	0.512	6.573E-65	1190	0.229	0.218	F4JXM9.pdb.gz	F4JXM9_ARATH Trafficking protein particle complex subunit-like protein OS=Arabidopsis thaliana OX=3702 GN=ROG2 PE=1 SV=1
5	AFDB:F4K0C4	0.380	0.350	6.118E-33	1259	0.155	0.140	F4K0C4.pdb.gz	TR130_ARATH Trafficking protein particle complex II-specific subunit 130 homolog OS=Arabidopsis thaliana OX=3702 GN=TRS130 PE=1 SV=1
6	AFDB:P48553	0.291	0.267	1.997E-31	1259	0.147	0.133	P48553.pdb.gz	TPC10_HUMAN Trafficking protein particle complex subunit 10 OS=Homo sapiens OX=9606 GN=TRAPPC10 PE=1 SV=2
7	AFDB:Q9VFB7	0.365	0.362	1.422E-29	1145	0.118	0.117	Q9VFB7.pdb.gz	TPC10_DROME Trafficking protein particle complex subunit 10 OS=Drosophila melanogaster OX=7227 GN=SIDL PE=1 SV=1
8	AFDB:Q03660	0.250	0.253	2.557E-28	1102	0.109	0.112	Q03660.pdb.gz	TR130_YEAST Trafficking protein particle complex II-specific subunit 130 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRS130 PE=1 SV=1
9	AFDB:Q9FY61	0.229	0.221	5.997E-26	1186	0.130	0.124	Q9FY61.pdb.gz	TR120_ARATH Trafficking protein particle complex II-specific subunit 120 homolog OS=Arabidopsis thaliana OX=3702 GN=TRS120 PE=1 SV=1
10	AFDB:O74501	0.224	0.221	7.823E-25	1150	0.107	0.105	O74501.pdb.gz	YCRE_SCHPO Uncharacterized protein CC285.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC285.14 PE=3 SV=1
11	PDB:7u05B	0.191	0.240	1.308E-19	815	0.100	0.139	7u05B.pdb.gz
12	PDB:7u05A	0.194	0.197	3.127E-19	1114	0.108	0.110	7u05A.pdb.gz
13	PDB:7sqcO0	0.158	0.157	1.067E-12	1140	0.074	0.074	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:7q1yA	0.109	0.093	3.580E-9	1374	0.054	0.044	7q1yA.pdb.gz
15	PDB:4g1eA	0.105	0.117	5.929E-9	964	0.053	0.062	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
16	PDB:7ea3J	0.157	0.187	6.499E-9	883	0.086	0.110	7ea3J.pdb.gz
17	PDB:4rtdA	0.095	0.096	1.235E-8	1122	0.054	0.054	4rtdA.pdb.gz
18	PDB:5a42A	0.107	0.081	1.417E-8	1597	0.053	0.038	5a42A.pdb.gz
19	PDB:4ziqA	0.099	0.082	2.573E-8	1450	0.056	0.043	4ziqA.pdb.gz
20	PDB:7q5zA	0.113	0.098	3.388E-8	1344	0.055	0.046	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1RLX4	0.0	1889	1132	0.785	0.785	TPC11_DANRE Trafficking protein particle complex subunit 11 OS=Danio rerio OX=7955 GN=trappc11 PE=2 SV=1
2	Q7Z392	0.0	2371	1133	1.000	1.000	TPC11_HUMAN Trafficking protein particle complex subunit 11 OS=Homo sapiens OX=9606 GN=TRAPPC11 PE=1 SV=2
3	Q8IRE3	8.95e-147	476	1320	0.242	0.208	Q8IRE3_DROME Trafficking protein particle complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=gry PE=1 SV=2
4	Q8IG85	6.18e-131	432	1252	0.222	0.201	Q8IG85_DROME Trafficking protein particle complex subunit 11 (Fragment) OS=Drosophila melanogaster OX=7227 GN=gry PE=2 SV=1
5	F4JXM9	5.29e-57	218	1190	0.251	0.239	F4JXM9_ARATH Trafficking protein particle complex subunit-like protein OS=Arabidopsis thaliana OX=3702 GN=ROG2 PE=1 SV=1
6	Q960U6	2.31e-21	103	961	0.068	0.080	Q960U6_DROME Trafficking protein particle complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=gry PE=2 SV=1
7	Q6ZQK5	0.60	36.6	770	0.019	0.027	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
8	Q5FVC7	0.65	36.6	770	0.019	0.027	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
9	Q5M755	0.94	35.4	273	0.020	0.084	PAP7_ARATH Fibrillin-5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FBN5 PE=1 SV=1
10	O77051	1.2	35.4	370	0.024	0.073	E2F2_DROME Transcription factor E2F2 OS=Drosophila melanogaster OX=7227 GN=E2f2 PE=1 SV=1
11	Q7KUQ6	2.3	35.0	2147	0.023	0.012	Q7KUQ6_DROME Limpet, isoform K OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=2
12	Q38FX1	3.2	34.3	627	0.012	0.022	Q38FX1_TRYB2 Sec1 family transport protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.0680 PE=3 SV=1
13	P16884	8.6	33.1	1072	0.022	0.023	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06159 DUF974	29	15.9	Protein of unknown function (DUF974)
2	PF11817 Foie-gras_1	1.3e-72	256.2	Foie gras liver health family 1
3	PF07919 Gryzun	2e-05	35.2	Gryzun, putative trafficking through Golgi
4	PF12742 Gryzun-like	2.1e-23	93.4	Gryzun, putative Golgi trafficking
5	PF02996 Prefoldin	2e+02	13.3	Prefoldin subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335371

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324318	0.994	Trafficking protein particle complex subunit 12
2	9606.ENSP00000302783	0.990	Trafficking protein particle complex subunit 1
3	9606.ENSP00000470262	0.984	Trafficking protein particle complex subunit 5
4	9606.ENSP00000283351	0.982	Trafficking protein particle complex subunit 8
5	9606.ENSP00000392495	0.982	Trafficking protein particle complex subunit 2
6	9606.ENSP00000480332	0.976	Trafficking protein particle complex subunit 3
7	9606.ENSP00000409231	0.972	Belongs to the TRAPPC13 family
8	9606.ENSP00000373979	0.968	Trafficking protein particle complex subunit 9
9	9606.ENSP00000330289	0.967	Trafficking protein particle complex subunit 6B
10	9606.ENSP00000006275	0.960	Trafficking protein particle complex subunit 6A
11	9606.ENSP00000291574	0.960	Trafficking protein particle complex subunit 10
12	9606.ENSP00000301021	0.959	Trafficking protein particle complex subunit 2-like protein
13	9606.ENSP00000436005	0.959	Trafficking protein particle complex subunit 4
14	9606.ENSP00000387286	0.933	Ras-related protein Rab-1A
15	9606.ENSP00000310226	0.910	Ras-related protein Rab-1B
16	9606.ENSP00000350386	0.902	Rab proteins geranylgeranyltransferase component A 1
17	9606.ENSP00000355511	0.902	Rab proteins geranylgeranyltransferase component A 2
18	9606.ENSP00000369538	0.900	Rab GDP dissociation inhibitor beta
19	9606.ENSP00000394071	0.900	Rab GDP dissociation inhibitor alpha
20	9606.ENSP00000357591	0.853	Trafficking protein particle complex subunit 3-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0010256	0.959	endomembrane system organization
GO:0007030	0.953	Golgi organization
GO:0065007	0.951	biological regulation
GO:0046907	0.859	intracellular transport
GO:0140352	0.824	export from cell
GO:0046903	0.819	secretion
GO:0048193	0.767	Golgi vesicle transport
GO:0032940	0.750	secretion by cell
GO:0008152	0.555	metabolic process
GO:0044238	0.422	primary metabolic process
GO:0071704	0.406	organic substance metabolic process
GO:0044237	0.399	cellular metabolic process
GO:0006807	0.369	nitrogen compound metabolic process
GO:0006888	0.368	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0050789	0.324	regulation of biological process
GO:0043170	0.305	macromolecule metabolic process
GO:0050794	0.300	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030008	1.000	TRAPP complex
GO:0005829	0.999	cytosol
GO:0005794	0.999	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]