StarFunc result for job id Q7Z3B3

User Input

>input (1105 residues)
MAAMAPALTDAAAEAHHIRFKLAPPSSTLSPGSAENNGNANILIAANGTKRKAIAAEDPS
LDFRNNPTKEDLGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYEL
RAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGK
RALTSSALHGGEMGGSESGDLKGGMTNCTLPHRSLDVEHTTLYSNNSTANKSSVNSMEQP
ALQGSSRLSPGTDSSSNLGGVKLEGKKSPLSSILFSALDSDTRITALLRRQADIESRARR
LQKRLQVVQAKQVERHIQHQLGGFLEKTLSKLPNLESLRPRSQLMLTRKAEAALRKAASE
TTTSEGLSNFLKSNSISEELERFTASGIANLRCSEQAFDSDVTDSSSGGESDIEEEELTR
ADPEQRHVPLRRRSEWKWAADRAAIVSRWNWLQAHVSDLEYRIRQQTDIYKQIRANKGLI
VLGEVPPPEHTTDLFLPLSSEVKTDHGTDKLIESVSQPLENHGARIIGHISESLSTKSCG
ALRPVNGVINTLQPVLADHIPGDSSDAEEQLHKKQRLNLVSSSSDGTCVAARTRPVLSCK
KRRLVRPNSIVPLSKKVHRNSTIRPGCDVNPSCALCGSGSINTMPPEIHYEAPLLERLSQ
LDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSAR
KDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHD
PNHSKMRLRDHSSERSEVLKHHTDMSSSSYLAATHHPPHSPLVRQLSTSSDSPAPASSSS
QVTASTSQQPVRRRRGESSFDINNIVIPMSVAATTRVEKLQYKEILTPSWREVDLQSLKG
SPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLG
SANPSTPQPASPDVSSSHSLSEYSHGQSPRSPISPELHSAPLTPVARDTPRHLASEDTRC
STPELGLDEQSVQPWERRTFPLAHSPQAECEDQLDAQERAARCTRRTSGSKTGRETEAAP
TSPPIVPLKSRHLVAAATAQRPTHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1W2PRB5	0.181	0.191	0.000	1041	0.940	0.998	A0A1W2PRB5.pdb.gz	A0A1W2PRB5_HUMAN KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=1
2	AFDB:F4I1T7	0.055	0.036	5.063E-7	1819	0.164	0.100	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
3	AFDB:Q8NB66	0.061	0.035	8.387E-6	2214	0.105	0.052	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
4	AFDB:D6XEJ8	0.036	0.026	8.914E-6	1736	0.143	0.091	D6XEJ8.pdb.gz	D6XEJ8_TRYB2 Flagellar Member 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.10 PE=4 SV=1
5	AFDB:Q17602	0.060	0.049	1.286E-5	1390	0.122	0.097	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
6	AFDB:Q54KI4	0.063	0.058	5.562E-5	1196	0.130	0.120	Q54KI4.pdb.gz	EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum OX=44689 GN=eps15 PE=1 SV=1
7	AFDB:P34216	0.036	0.030	1.157E-4	1381	0.141	0.113	P34216.pdb.gz	EDE1_YEAST EH domain-containing and endocytosis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EDE1 PE=1 SV=2
8	AFDB:P35658	0.050	0.029	1.230E-4	2090	0.176	0.093	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
9	AFDB:M9PF57	0.049	0.041	1.389E-4	1385	0.145	0.116	M9PF57.pdb.gz	M9PF57_DROME Uncharacterized protein, isoform M OS=Drosophila melanogaster OX=7227 GN=CG8154 PE=1 SV=1
10	AFDB:O77086	0.053	0.040	2.406E-4	1571	0.138	0.097	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
11	PDB:6mdmH	0.061	0.332	9.774E-1	147	0.022	0.163	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
12	PDB:7emfK	0.040	0.343	1.693	112	0.020	0.196	7emfK.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:7rroA1	0.056	0.128	2.441	396	0.033	0.091	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:5wlcNB	0.041	0.174	4.777	142	0.022	0.169	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
15	PDB:7ungB0	0.056	0.224	5.737	193	0.019	0.109	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:5bw9g	0.054	0.210	7.323	141	0.013	0.099	5bw9g.pdb.gz
17	PDB:2hh7A	0.033	0.259	7.784	85	0.015	0.200	2hh7A.pdb.gz
18	PDB:4gwpA	0.038	0.225	7.784	112	0.016	0.161	4gwpA.pdb.gz
19	PDB:3k29A	0.048	0.234	8.274	162	0.030	0.204	3k29A.pdb.gz
20	PDB:4o9yA	0.043	0.023	8.274	2490	0.040	0.018	4o9yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2PPV8	0.0	1502	897	0.666	0.821	A0A1W2PPV8_HUMAN KAT8 regulatory NSL complex subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=1
2	A0A1W2PRB5	0.0	1499	1041	0.666	0.707	A0A1W2PRB5_HUMAN KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=1
3	A0A3B3IT55	0.0	2137	1061	0.959	0.999	A0A3B3IT55_HUMAN KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=1
4	I3L233	0.0	1378	678	0.613	0.999	I3L233_HUMAN KAT8 regulatory NSL complex subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=2
5	Q7Z3B3	0.0	2250	1105	1.000	1.000	KANL1_HUMAN KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=3
6	Q80TG1	0.0	1363	1036	0.611	0.652	KANL1_MOUSE KAT8 regulatory NSL complex subunit 1 OS=Mus musculus OX=10090 GN=Kansl1 PE=1 SV=1
7	A0A0B4K6I8	1.93e-17	90.5	982	0.085	0.096	A0A0B4K6I8_DROME Non-specific lethal 1, isoform K OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
8	E1JIM1	1.98e-17	90.5	936	0.085	0.100	E1JIM1_DROME Non-specific lethal 1, isoform J OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
9	A0A0B4K6Z4	2.08e-17	90.5	981	0.085	0.096	A0A0B4K6Z4_DROME Non-specific lethal 1, isoform L OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
10	E2QD16	2.25e-17	90.5	1570	0.084	0.059	E2QD16_DROME Non-specific lethal 1, isoform M OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
11	A0A0B4K690	2.36e-17	90.5	1551	0.084	0.060	A0A0B4K690_DROME Non-specific lethal 1, isoform O OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
12	A0A0B4K663	2.41e-17	90.5	1569	0.084	0.059	A0A0B4K663_DROME Non-specific lethal 1, isoform N OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
13	A4V2Z1	2.73e-17	90.5	1550	0.084	0.060	A4V2Z1_DROME Non-specific lethal 1, isoform D OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
14	E1JIM0	2.75e-17	90.1	1549	0.084	0.060	E1JIM0_DROME Non-specific lethal 1, isoform E OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
15	Q0KI68	2.84e-17	90.1	1548	0.084	0.060	Q0KI68_DROME Non-specific lethal 1, isoform F OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=2
16	Q5A1N6	0.35	37.4	465	0.028	0.067	CG13_CANAL G1/S-specific cyclin CLN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CLN3 PE=1 SV=1
17	Q9ZFE4	1.5	34.7	265	0.021	0.087	FABI_PSEAE Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=fabI PE=1 SV=1
18	A0A0G2JTK1	2.2	35.0	1307	0.031	0.026	A0A0G2JTK1_RAT Tau tubulin kinase 1 OS=Rattus norvegicus OX=10116 GN=Ttbk1 PE=1 SV=2
19	Q6PCN3	3.1	34.3	1308	0.031	0.026	TTBK1_MOUSE Tau-tubulin kinase 1 OS=Mus musculus OX=10090 GN=Ttbk1 PE=1 SV=3
20	Q7ZVU3	5.5	33.5	583	0.012	0.022	Q7ZVU3_DANRE Cobra1 protein OS=Danio rerio OX=7955 GN=cobra1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15275 PEHE	2.2e-30	117.5	PEHE domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262419

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351446	0.999	WD repeat-containing protein 5
2	9606.ENSP00000406037	0.999	Histone acetyltransferase KAT8
3	9606.ENSP00000415436	0.999	KAT8 regulatory NSL complex subunit 2
4	9606.ENSP00000363124	0.996	PHD finger protein 20
5	9606.ENSP00000349640	0.989	Microspherule protein 1
6	9606.ENSP00000396749	0.989	KAT8 regulatory NSL complex subunit 3
7	9606.ENSP00000264515	0.947	Retinoblastoma-binding protein 5
8	9606.ENSP00000309555	0.929	Host cell factor 1
9	9606.ENSP00000382863	0.925	Chromodomain-helicase-DNA-binding protein 8
10	9606.ENSP00000436786	0.913	Histone-lysine N-methyltransferase 2A
11	9606.ENSP00000314029	0.905	Sentrin-specific protease 3
12	9606.ENSP00000318297	0.905	RuvB-like 1
13	9606.ENSP00000252996	0.902	Transcription initiation factor TFIID subunit 4
14	9606.ENSP00000364037	0.902	Testis-expressed protein 10
15	9606.ENSP00000370936	0.902	Transcription factor E2F6
16	9606.ENSP00000219905	0.900	MAX gene-associated protein
17	9606.ENSP00000301396	0.900	Proline-, glutamic acid- and leucine-rich protein 1
18	9606.ENSP00000312709	0.900	Transcription initiation factor TFIID subunit 7
19	9606.ENSP00000324122	0.900	U4/U6 small nuclear ribonucleoprotein Prp31
20	9606.ENSP00000351490	0.900	Protein max

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0071704	0.996	organic substance metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0043967	0.986	histone H4 acetylation
GO:0031399	0.982	regulation of protein modification process
GO:0031325	0.979	positive regulation of cellular metabolic process
GO:0051173	0.969	positive regulation of nitrogen compound metabolic process
GO:0010604	0.967	positive regulation of macromolecule metabolic process
GO:0031056	0.962	regulation of histone modification
GO:0031401	0.932	positive regulation of protein modification process
GO:0031058	0.916	positive regulation of histone modification
GO:0031062	0.865	positive regulation of histone methylation
GO:0009987	0.798	cellular process
GO:0010468	0.698	regulation of gene expression
GO:0071840	0.369	cellular component organization or biogenesis
GO:0016043	0.362	cellular component organization
GO:0019219	0.350	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.854	protein-containing complex
GO:0043232	0.769	intracellular non-membrane-bounded organelle
GO:1902494	0.689	catalytic complex
GO:1990234	0.682	transferase complex
GO:0005694	0.461	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]