StarFunc result for job id Q7Z3F1

User Input

>input (870 residues)
MNSNLPAENLTIAVNMTKTLPTAVTHGFNSTNDPPSMSITRLFPALLECFGIVLCGYIAG
RANVITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWSFLYSILIAKASVFFIVCVL
TLLVASPDSRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPEYLQYIYLVAPISLMML
NPIGFIFCEIQKWKDTQNASQNKIKIVGLGLLRVLQNPIVFMVFIGIAFNFILDRKVPVY
VENFLDGLGNSFSGSALFYLGLTMVGKIKRLKKSAFVVLILLITAKLLVLPLLCREMVEL
LDKGDSVVNHTSLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVISTFVSAPIMYV
SAWLLTFPTMDPKPLAYAIQNVSFDISIVSLISLIWSLAILLLSKKYKQLPHMLTTNLLI
AQSIVCAGMMIWNFVKEKNFVGQILVFVLLYSSLYSTYLWTGLLAISLFLLKKRERVQIP
VGIIIISGWGIPALLVGVLLITGKHNGDSIDSAFFYGKEQMITTAVTLFCSILIAGISLM
CMNQTAQAGSYEGFDQSQSHKVVEPGNTAFEESPAPVNEPELFTSSIPETSCCSCSMGNG
ELHCPSIEPIANTSTSEPVIPSFEKNNHCVSRCNSQSCILAQEEEQYLQSGDQQLTRHVL
LCLLLIIGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIIL
PFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGT
FCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEFRDEYLFYRFLQKSPEQ
SPPAINANTLQQERYKEIEHSSPPSHSPKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3F1	1.000	1.000	0.000	870	1.000	1.000	Q7Z3F1.pdb.gz	LYCHS_HUMAN Lysosomal cholesterol signaling protein OS=Homo sapiens OX=9606 GN=GPR155 PE=1 SV=2
2	AFDB:M9PFK5	0.672	0.619	6.371E-45	957	0.345	0.313	M9PFK5.pdb.gz	M9PFK5_DROME Anchor, isoform B OS=Drosophila melanogaster OX=7227 GN=anchor PE=4 SV=1
3	PDB:7qp9A	0.308	0.735	2.905E-10	327	0.077	0.205	7qp9A.pdb.gz	Structures and mechanism of the plant PIN-FORMED auxin transporter.
4	AFDB:Q9LFP6	0.317	0.690	3.801E-9	367	0.080	0.191	Q9LFP6.pdb.gz	PIN8_ARATH Auxin efflux carrier component 8 OS=Arabidopsis thaliana OX=3702 GN=PIN8 PE=1 SV=1
5	AFDB:P0AA49	0.304	0.769	1.408E-8	314	0.075	0.207	P0AA49.pdb.gz	YFDV_ECOLI Uncharacterized transporter YfdV OS=Escherichia coli (strain K12) OX=83333 GN=yfdV PE=3 SV=1
6	PDB:7y9tA	0.325	0.699	1.420E-8	380	0.068	0.155	7y9tA.pdb.gz
7	PDB:7wkwB	0.324	0.702	1.476E-8	377	0.071	0.164	7wkwB.pdb.gz	Structures and mechanisms of the Arabidopsis auxin transporter PIN3.
8	AFDB:P38355	0.277	0.512	1.818E-5	427	0.062	0.126	P38355.pdb.gz	YB8B_YEAST Uncharacterized transporter YBR287W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR287W PE=1 SV=1
9	AFDB:Q9NQS5	0.248	0.509	4.276E-4	396	0.051	0.111	Q9NQS5.pdb.gz	GPR84_HUMAN G-protein coupled receptor 84 OS=Homo sapiens OX=9606 GN=GPR84 PE=1 SV=1
10	AFDB:B3DKN8	0.246	0.403	5.599E-4	495	0.062	0.109	B3DKN8.pdb.gz	B3DKN8_DANRE Muscarinic acetylcholine receptor OS=Danio rerio OX=7955 GN=chrm2 PE=2 SV=1
11	AFDB:P19327	0.248	0.461	5.599E-4	422	0.057	0.118	P19327.pdb.gz	5HT1A_RAT 5-hydroxytryptamine receptor 1A OS=Rattus norvegicus OX=10116 GN=Htr1a PE=1 SV=1
12	AFDB:P08173	0.258	0.438	6.284E-4	479	0.069	0.125	P08173.pdb.gz	ACM4_HUMAN Muscarinic acetylcholine receptor M4 OS=Homo sapiens OX=9606 GN=CHRM4 PE=1 SV=2
13	AFDB:O94744	0.193	0.315	1.646E-3	466	0.061	0.114	O94744.pdb.gz	GIT3_SCHPO Glucose receptor protein git3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=git3 PE=3 SV=1
14	PDB:7pe9I	0.088	0.222	1.550E-2	317	0.028	0.076	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
15	PDB:7rx9A	0.085	0.161	2.367E-2	432	0.028	0.056	7rx9A.pdb.gz
16	PDB:6pcvA	0.090	0.104	3.348E-2	754	0.031	0.036	6pcvA.pdb.gz
17	PDB:7evwR	0.243	0.565	1.148E-1	340	0.041	0.106	7evwR.pdb.gz
18	PDB:2byvE	0.099	0.094	1.339E-1	922	0.037	0.035	2byvE.pdb.gz
19	PDB:6lw5A	0.211	0.374	2.480E-1	427	0.049	0.101	6lw5A.pdb.gz	Structural basis of ligand binding modes at the human formyl peptide receptor 2.
20	PDB:7vqxR	0.165	0.361	2.480E-1	361	0.046	0.111	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3F1	0.0	1785	870	1.000	1.000	LYCHS_HUMAN Lysosomal cholesterol signaling protein OS=Homo sapiens OX=9606 GN=GPR155 PE=1 SV=2
2	M9PFK5	1.34e-116	379	957	0.247	0.225	M9PFK5_DROME Anchor, isoform B OS=Drosophila melanogaster OX=7227 GN=anchor PE=4 SV=1
3	Q8TB45	1.28e-08	60.5	409	0.040	0.086	DPTOR_HUMAN DEP domain-containing mTOR-interacting protein OS=Homo sapiens OX=9606 GN=DEPTOR PE=1 SV=2
4	Q69ZK0	1.83e-08	60.8	1650	0.029	0.015	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
5	D3ZS72	2.09e-08	60.8	1635	0.029	0.015	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
6	A0A8I6GLR6	2.11e-08	60.8	1646	0.029	0.015	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
7	Q8TCU6	2.36e-08	60.5	1659	0.029	0.015	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
8	Q3LAC4	5.43e-08	59.3	1598	0.033	0.018	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
9	Q70Z35	6.22e-08	59.3	1606	0.033	0.018	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
10	F1R6J2	1.02e-07	58.5	1622	0.028	0.015	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
11	Q9EQZ6	2.26e-07	57.4	1011	0.031	0.027	RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus OX=10090 GN=Rapgef4 PE=1 SV=1
12	Q8WZA2	2.97e-07	57.0	1011	0.030	0.026	RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=RAPGEF4 PE=1 SV=1
13	B2KTE4	1.84e-04	47.8	2075	0.034	0.014	B2KTE4_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
14	B2KTE2	1.89e-04	47.8	2084	0.034	0.014	B2KTE2_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
15	B2KTE1	1.91e-04	47.8	2100	0.034	0.014	B2KTE1_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
16	B2KTE3	1.96e-04	47.8	2091	0.034	0.014	B2KTE3_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
17	P47170	4.62e-04	46.6	1584	0.028	0.015	IML1_YEAST Vacuolar membrane-associated protein IML1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IML1 PE=1 SV=1
18	Q9Y2I7	7.15e-04	45.8	2098	0.032	0.013	FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3
19	Q9Z1T6	7.40e-04	45.8	2097	0.032	0.013	FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus OX=10090 GN=Pikfyve PE=1 SV=3
20	Q86SQ4	0.002	44.7	1221	0.052	0.037	AGRG6_HUMAN Adhesion G-protein coupled receptor G6 OS=Homo sapiens OX=9606 GN=ADGRG6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	1.6e-10	52.2	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF03547 Mem_trans	5.1e-13	59.8	Membrane transport protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376335

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000423505	0.785	Tetratricopeptide repeat domain containing
2	9606.ENSP00000237536	0.776	Protein SOGA1
3	9606.ENSP00000440190	0.695	Tudor domain-containing protein 3
4	9606.ENSP00000251119	0.669	Zinc finger FYVE domain-containing protein 26
5	9606.ENSP00000255120	0.658	Nuclear autoantigenic sperm protein
6	9606.ENSP00000376609	0.560	G protein-coupled receptor kinase 5
7	9606.ENSP00000386711	0.558	Janus kinase and microtubule-interacting protein 1
8	9606.ENSP00000304051	0.544	E3 ubiquitin-protein ligase RNF139
9	9606.ENSP00000252660	0.537	Proto-oncogene Mas
10	9606.ENSP00000355925	0.533	Prospero homeobox protein 1
11	9606.ENSP00000272430	0.517	Rhotekin
12	9606.ENSP00000355551	0.511	Integral membrane protein GPR137B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005215	0.977	transporter activity
GO:0022857	0.867	transmembrane transporter activity
GO:0038023	0.793	signaling receptor activity
GO:0004888	0.371	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050890	0.989	cognition
GO:0065007	0.515	biological regulation
GO:0009987	0.513	cellular process
GO:0050794	0.479	regulation of cellular process
GO:0050896	0.453	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.996	extracellular exosome
GO:0016020	0.964	membrane
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0005737	0.953	cytoplasm
GO:0071944	0.790	cell periphery
GO:0005886	0.579	plasma membrane
GO:0012505	0.537	endomembrane system
GO:0031090	0.341	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]