StarFunc result for job id Q7Z3J2

User Input

>input (963 residues)
MAVFPWHSRNRNYKAEFASCRLEAVPLEFGDYHPLKPITVTESKTKKVNRKGSTSSTSSS
SSSSVVDPLSSVLDGTDPLSMFAATADPAALAAAMDSSRRKRDRDDNSVVGSDFEPWTNK
RGEILARYTTTEKLSINLFMGSEKGKAGTATLAMSEKVRTRLEELDDFEEGSQKELLNLT
QQDYVNRIEELNQSLKDAWASDQKVKALKIVIQCSKLLSDTSVIQFYPSKFVLITDILDT
FGKLVYERIFSMCVDSRSVLPDHFSPENANDTAKETCLNWFFKIASIRELIPRFYVEASI
LKCNKFLSKTGISECLPRLTCMIRGIGDPLVSVYARAYLCRVGMEVAPHLKETLNKNFFD
FLLTFKQIHGDTVQNQLVVQGVELPSYLPLYPPAMDWIFQCISYHAPEALLTEMMERCKK
LGNNALLLNSVMSAFRAEFIATRSMDFIGMIKECDESGFPKHLLFRSLGLNLALADPPES
DRLQILNEAWKVITKLKNPQDYINCAEVWVEYTCKHFTKREVNTVLADVIKHMTPDRAFE
DSYPQLQLIIKKVIAHFHDFSVLFSVEKFLPFLDMFQKESVRVEVCKCIMDAFIKHQQEP
TKDPVILNALLHVCKTMHDSVNALTLEDEKRMLSYLINGFIKMVSFGRDFEQQLSFYVES
RSMFCNLEPVLVQLIHSVNRLAMETRKVMKGNHSRKTAAFVRACVAYCFITIPSLAGIFT
RLNLYLHSGQVALANQCLSQADAFFKAAISLVPEVPKMINIDGKMRPSESFLLEFLCNFF
STLLIVPDHPEHGVLFLVRELLNVIQDYTWEDNSDEKIRIYTCVLHLLSAMSQETYLYHI
DKVDSNDSLYGGDSKFLAENNKLCETVMAQILEHLKTLAKDEALKRQSSLGLSFFNSILA
HGDLRNNKLNQLSVNLWHLAQRHGCADTRTMVKTLEYIKKQSKQPDMTHLTELALRLPLQ
TRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3J2	1.000	1.000	0.000	963	1.000	1.000	Q7Z3J2.pdb.gz	VP35L_HUMAN VPS35 endosomal protein-sorting factor-like OS=Homo sapiens OX=9606 GN=VPS35L PE=1 SV=2
2	PDB:7u6fD1	0.373	0.471	5.518E-9	733	0.111	0.146	7u6fD1.pdb.gz
3	PDB:7blnA	0.388	0.472	2.856E-8	769	0.112	0.140	7blnA.pdb.gz
4	PDB:3w3uA	0.230	0.217	3.815E-5	1030	0.096	0.089	3w3uA.pdb.gz
5	AFDB:Q9VT41	0.213	0.207	4.381E-5	1001	0.108	0.104	Q9VT41.pdb.gz	INT7_DROME Integrator complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=defl PE=1 SV=1
6	PDB:6xu2A	0.193	0.177	5.914E-5	1091	0.136	0.120	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
7	AFDB:Q96AY4	0.180	0.086	8.153E-5	2481	0.089	0.035	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
8	PDB:7ni5A	0.245	0.106	9.864E-5	2791	0.116	0.040	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
9	PDB:4c0qA	0.214	0.231	1.184E-4	871	0.107	0.118	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
10	AFDB:Q9XVI2	0.178	0.198	1.360E-4	811	0.113	0.134	Q9XVI2.pdb.gz	Q9XVI2_CAEEL SYmmetrical Sister cell hermaphrodite gonad defect OS=Caenorhabditis elegans OX=6239 GN=sys-1 PE=1 SV=1
11	PDB:7sqcR1	0.174	0.098	1.474E-4	2080	0.110	0.051	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:3s4wB	0.184	0.162	1.529E-4	1146	0.116	0.098	3s4wB.pdb.gz
13	PDB:7n6g1N	0.169	0.090	1.770E-4	2179	0.102	0.045	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
14	PDB:3gb8A	0.264	0.265	1.904E-4	958	0.112	0.113	3gb8A.pdb.gz
15	AFDB:Q9FR53	0.157	0.085	4.069E-4	2481	0.114	0.044	Q9FR53.pdb.gz	TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana OX=3702 GN=TOR PE=1 SV=1
16	AFDB:E7FB07	0.208	0.197	6.081E-4	1047	0.116	0.107	E7FB07.pdb.gz	E7FB07_DANRE Armadillo repeat containing 4 OS=Danio rerio OX=7955 GN=armc4 PE=1 SV=1
17	AFDB:E1B8W3	0.168	0.158	6.786E-4	1044	0.100	0.092	E1B8W3.pdb.gz	ODAD2_BOVIN Outer dynein arm-docking complex subunit 2 OS=Bos taurus OX=9913 GN=ODAD2 PE=1 SV=3
18	AFDB:Q9M033	0.137	0.104	1.052E-3	1467	0.102	0.067	Q9M033.pdb.gz	Q9M033_ARATH HEAT repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=ESP4 PE=1 SV=1
19	AFDB:Q9D2X5	0.179	0.251	1.516E-3	619	0.082	0.128	Q9D2X5.pdb.gz	SCC4_MOUSE MAU2 chromatid cohesion factor homolog OS=Mus musculus OX=10090 GN=Mau2 PE=1 SV=3
20	AFDB:Q9Y6J0	0.144	0.085	2.266E-3	2220	0.108	0.047	Q9Y6J0.pdb.gz	CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3J2	0.0	2005	963	1.000	1.000	VP35L_HUMAN VPS35 endosomal protein-sorting factor-like OS=Homo sapiens OX=9606 GN=VPS35L PE=1 SV=2
2	Q9Y1W0	1.7	34.7	464	0.026	0.054	FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum OX=44689 GN=fadA PE=1 SV=1
3	Q9ZWJ9	2.7	34.3	664	0.019	0.027	ARR2_ARATH Two-component response regulator ARR2 OS=Arabidopsis thaliana OX=3702 GN=ARR2 PE=1 SV=1
4	Q86MG7	5.0	32.7	251	0.047	0.179	Q86MG7_CAEEL Ribonuclease H1 OS=Caenorhabditis elegans OX=6239 GN=rnh-1.0 PE=1 SV=1
5	Q38AZ1	6.1	33.5	3241	0.031	0.009	Q38AZ1_TRYB2 Neurobeachin/beige protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0690 PE=4 SV=1
6	Q8VZA0	6.5	33.1	936	0.049	0.050	SIEL_ARATH Protein SIEL OS=Arabidopsis thaliana OX=3702 GN=SIEL PE=1 SV=1
7	Q8T9W2	7.9	32.7	697	0.018	0.024	ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum OX=44689 GN=abcB5 PE=3 SV=1
8	Q54UC0	8.8	32.7	4299	0.023	0.005	PRKDC_DICDI DNA-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum OX=44689 GN=dnapkcs PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251143

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365477	0.988	Coiled-coil domain-containing protein 93
2	9606.ENSP00000365401	0.981	Coiled-coil domain-containing protein 22
3	9606.ENSP00000480853	0.980	Vacuolar protein sorting-associated protein 29
4	9606.ENSP00000311399	0.975	Down syndrome critical region gene 3
5	9606.ENSP00000267935	0.945	COMM domain-containing protein 4
6	9606.ENSP00000419475	0.922	COMM domain-containing protein 2
7	9606.ENSP00000308236	0.921	COMM domain-containing protein 1
8	9606.ENSP00000366032	0.919	COMM domain-containing protein 3
9	9606.ENSP00000348054	0.881	COMM domain containing 6
10	9606.ENSP00000274458	0.861	COMM domain-containing protein 10
11	9606.ENSP00000354688	0.839	Protein FAM45A
12	9606.ENSP00000370984	0.743	COMM domain-containing protein 8
13	9606.ENSP00000479919	0.732	Endophilin-B1
14	9606.ENSP00000263401	0.725	COMM domain-containing protein 9
15	9606.ENSP00000233575	0.679	Sorting nexin-17
16	9606.ENSP00000295688	0.663	T-complex protein 1 subunit gamma
17	9606.ENSP00000394331	0.659	COMM domain-containing protein 5
18	9606.ENSP00000299138	0.657	Vacuolar protein sorting-associated protein 35
19	9606.ENSP00000318016	0.630	WASH complex subunit 5
20	9606.ENSP00000484713	0.610	WASH complex subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0016197	0.976	endosomal transport
GO:0032456	0.970	endocytic recycling
GO:0048193	0.909	Golgi vesicle transport
GO:0006892	0.899	post-Golgi vesicle-mediated transport
GO:0006893	0.791	Golgi to plasma membrane transport
GO:0065007	0.429	biological regulation
GO:0050794	0.342	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	1.000	endosome
GO:0098588	0.999	bounding membrane of organelle
GO:0030659	0.999	cytoplasmic vesicle membrane
GO:0005886	0.998	plasma membrane
GO:0030141	0.995	secretory granule
GO:0101002	0.994	ficolin-1-rich granule
GO:0070820	0.993	tertiary granule
GO:0101003	0.977	ficolin-1-rich granule membrane
GO:0005829	0.914	cytosol
GO:0032991	0.784	protein-containing complex
GO:0070013	0.552	intracellular organelle lumen
GO:0005634	0.527	nucleus
GO:0010008	0.441	endosome membrane
GO:0000323	0.426	lytic vacuole
GO:0005774	0.415	vacuolar membrane
GO:0005764	0.404	lysosome
GO:0005576	0.387	extracellular region
GO:0098852	0.368	lytic vacuole membrane
GO:0005615	0.366	extracellular space
GO:0005769	0.363	early endosome
GO:0005765	0.363	lysosomal membrane
GO:0031981	0.309	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]