StarFunc result for job id Q7Z3J3

User Input

>input (1758 residues)
MSCSKAYGERYVASVQGSAPSPRKKSTRGFYFAKLYYEAKEYDLAKKYICTYINVREMDP
RAHRFLGLLYELEENTEKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVER
AAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVARCHEAERNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYA
NLMLLTLSTRDVQESRELLESFDSALQSAKSSLGGNDELSATFLEMKGHFYMHAGSLLLK
MGQHGNNVQWRALSELAALCYLIAFQVPRPKIKLIKGEAGQNLLEMMACDRLSQSGHMLL
NLSRGKQDFLKVVVETFANKSGQSALYDALFSSQSPKDTSFLGSDDIGNIDVQEPELEDL
ARYDVGAIRAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHHLPQETSRLETNAPESI
CILDLEVFLLGVVYTSHLQLKEKCNSHHSSYQPLCLPLPVCKQLCTERQKSWWDAVCTLI
HRKAVPGNSAKLRLLVQHEINTLRAQEKHGLQPALLVHWAKCLQKMGSGLNSFYDQREYI
GRSVHYWKKVLPLLKIIKKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDAHVTFAILDA
VNGNIEDAMTAFESIKSVVSYWNLALIFHRKAEDIANDALSPEEQEECKNYLRKTRGYLI
KILDDSDSNLSVVKKLPVPLESVKEMLKSVMQELENYSEGDPLYKNGSLRNADSEIKHST
PSPTKYSLSPSKSYKYSPKTPPRWAEDQNSLLKMIRQEVKAIKEEMQELKLNSSKSASHH
RWPTENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTK
GSSNTEFKSTKEGFSIPVSADGFKFGISEPGNQEKESEKPLENDTGFQAQDISGQKNGRG
VIFGQTSSTFTFADVAKSTSGEGFQFGKKDPNFKGFSGAGEKLFSSQCGKMANKANTSGD
FEKDDDAYKTEDSDDIHFEPVVQMPEKVELVIGEEGEKVLYSQGVKLFRFDAEVRQWKER
GLGNLKILKNEVNGKPRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWSASDFSDG
DAKLERLAAKFKTPELAEEFKQKFEECQQLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKS
GLKDFKTFLTNDQTKVTEEENKGSGTGAAGASDTTIKPNPENTGPTLEWDNCDLREDALD
DSVSSSSVHASPLASSPVRKNLFHFGESTTGSNFSFKSALSPSKSPAKLNQSGTSVGTDE
ESDVTQEEERDGQYFEPVVPLPDLVEVSSGEENEKVVFSHRAELYRYDKDVGQWKERGIG
DIKILQNYDNKQVRIVMRRDQVLKLCANHTITPDMSLQNMKGTERVWVWTACDFADGERK
VEHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLITPHVSRSSTPRESPCGKIAVAVLEET
TRERTDVIQGDDVADAASEVEVSSTSETTTKAVVSPPKFVFGSESVKRIFSSEKSKPFAF
GNSSATGSLFGFSFNASLKSNNSETSSVAQSGSESKVEPKKCELSKNSDIEQSSDSKVKN
LSASFPMEESSINYTFKTPEKEPPLWHAEFTKEELVQKLSSTTKSADHLNGLLREAEATS
AVLMEQIKLLKSEIRRLERNQEQEESAANVEHLKNVLLQFIFLKPGSERERLLPVINTML
QLSPEEKGKLAAVAQGEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7r5j00	0.404	0.904	1.284E-82	756	0.411	0.955	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
2	AFDB:P41920	0.071	0.602	4.889E-12	201	0.046	0.403	P41920.pdb.gz	YRB1_YEAST Ran-specific GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB1 PE=1 SV=1
3	AFDB:Q8RWG8	0.074	0.576	5.917E-12	217	0.041	0.332	Q8RWG8.pdb.gz	RBP1B_ARATH Ran-binding protein 1 homolog b OS=Arabidopsis thaliana OX=3702 GN=RANBP1B PE=1 SV=2
4	AFDB:P92985	0.074	0.574	1.537E-11	219	0.042	0.333	P92985.pdb.gz	RBP1C_ARATH Ran-binding protein 1 homolog c OS=Arabidopsis thaliana OX=3702 GN=RANBP1C PE=2 SV=1
5	AFDB:Q9LMK7	0.074	0.550	1.597E-11	228	0.042	0.325	Q9LMK7.pdb.gz	RBP1A_ARATH Ran-binding protein 1 homolog a OS=Arabidopsis thaliana OX=3702 GN=RANBP1A PE=1 SV=1
6	AFDB:A0A1D8PRQ3	0.070	0.566	3.992E-11	212	0.039	0.321	A0A1D8PRQ3.pdb.gz	A0A1D8PRQ3_CANAL Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YRB1 PE=4 SV=1
7	PDB:1k5dB	0.072	0.830	7.094E-11	146	0.039	0.466	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
8	PDB:3m1iB	0.070	0.907	3.526E-10	131	0.034	0.450	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
9	AFDB:Q6PR54	0.070	0.058	7.265E-10	2419	0.138	0.100	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
10	AFDB:E1C2U2	0.089	0.073	4.370E-9	2326	0.137	0.103	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
11	PDB:7dkhI	0.083	0.141	4.729E-9	914	0.053	0.102	7dkhI.pdb.gz
12	AFDB:Q5UIP0	0.083	0.068	1.225E-8	2472	0.143	0.102	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
13	PDB:4bujB	0.099	0.121	7.111E-8	1367	0.054	0.069	4bujB.pdb.gz
14	AFDB:Q9VW83	0.067	0.065	2.407E-7	1847	0.114	0.108	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
15	PDB:7qdrB	0.104	0.146	1.199E-6	1212	0.069	0.101	7qdrB.pdb.gz
16	PDB:6tedQ	0.092	0.155	1.246E-6	890	0.061	0.120	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
17	PDB:6yj6A	0.077	0.128	2.673E-6	819	0.055	0.118	6yj6A.pdb.gz
18	AFDB:Q9VUH6	0.057	0.055	4.216E-6	1833	0.120	0.115	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
19	PDB:6c95A	0.112	0.221	1.434E-5	773	0.047	0.107	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
20	PDB:7ntfA	0.090	0.164	3.725E-5	918	0.043	0.083	7ntfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5YC36	0.0	1276	3114	0.374	0.211	A0A8I5YC36_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=1
2	D4A054	0.0	1276	3061	0.374	0.215	D4A054_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=3
3	M0R3M4	0.0	1276	3089	0.374	0.213	M0R3M4_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=2
4	P49792	0.0	1420	3224	0.404	0.220	RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2
5	Q9ERU9	0.0	1300	3053	0.374	0.215	RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus OX=10090 GN=Ranbp2 PE=1 SV=2
6	Q8IWJ2	1.26e-59	229	1684	0.064	0.067	GCC2_HUMAN GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4
7	A0A0B4K7J2	3.02e-56	219	2718	0.083	0.054	RBP2_DROME E3 SUMO-protein ligase RanBP2 OS=Drosophila melanogaster OX=7227 GN=Nup358 PE=1 SV=1
8	Q8CHG3	2.90e-53	209	1680	0.057	0.060	GCC2_MOUSE GRIP and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gcc2 PE=1 SV=3
9	P41920	5.08e-39	147	201	0.045	0.393	YRB1_YEAST Ran-specific GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB1 PE=1 SV=1
10	A0A140VK94	1.42e-35	137	201	0.042	0.363	A0A140VK94_HUMAN RAN binding protein 1, isoform CRA_g OS=Homo sapiens OX=9606 GN=RANBP1 PE=2 SV=1
11	P34022	1.42e-35	137	203	0.043	0.374	RANG_MOUSE Ran-specific GTPase-activating protein OS=Mus musculus OX=10090 GN=Ranbp1 PE=1 SV=2
12	P43487	1.42e-35	137	201	0.042	0.363	RANG_HUMAN Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
13	A0A8I5ZTU5	1.90e-35	137	219	0.040	0.320	A0A8I5ZTU5_RAT RAN binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ranbp1 PE=1 SV=1
14	D4A2G9	3.59e-35	135	188	0.040	0.372	D4A2G9_RAT RAN binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ranbp1 PE=1 SV=2
15	F6WQW2	6.27e-35	137	278	0.043	0.273	F6WQW2_HUMAN RAN binding protein 1 OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
16	Q21021	3.85e-33	142	860	0.035	0.072	Q21021_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-9 PE=1 SV=2
17	A0A1D8PRQ3	7.26e-33	129	212	0.034	0.283	A0A1D8PRQ3_CANAL Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YRB1 PE=4 SV=1
18	Q9LMK7	1.71e-30	123	228	0.035	0.272	RBP1A_ARATH Ran-binding protein 1 homolog a OS=Arabidopsis thaliana OX=3702 GN=RANBP1A PE=1 SV=1
19	C9JJ34	1.91e-30	120	163	0.035	0.380	C9JJ34_HUMAN RAN binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
20	P92985	5.36e-30	121	219	0.038	0.301	RBP1C_ARATH Ran-binding protein 1 homolog c OS=Arabidopsis thaliana OX=3702 GN=RANBP1C PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01465 GRIP	3.2e-12	57.4	GRIP domain
2	PF16704 Rab_bind	2e-33	125.6	Rab binding domain
3	PF00638 Ran_BP1	6.6e-104	354.2	RanBP1 domain
4	PF00515 TPR_1	0.0082	27.1	Tetratricopeptide repeat
5	PF13414 TPR_11	37	15.4	TPR repeat
6	PF13424 TPR_12	2.5e+02	13.3	Tetratricopeptide repeat
7	PF13428 TPR_14	4.5	19.3	Tetratricopeptide repeat
8	PF13432 TPR_16	31	16.6	Tetratricopeptide repeat
9	PF14559 TPR_19	1.5	20.6	Tetratricopeptide repeat
10	PF07719 TPR_2	0.0076	27.3	Tetratricopeptide repeat
11	PF13174 TPR_6	2.3e+02	13.9	Tetratricopeptide repeat
12	PF13176 TPR_7	97	14.4	Tetratricopeptide repeat
13	PF13181 TPR_8	0.026	25.7	Tetratricopeptide repeat
14	PF13371 TPR_9	63	15.1	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386810

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000446215	0.745	GTP-binding nuclear protein Ran
2	9606.ENSP00000384863	0.691	Exportin-1
3	9606.ENSP00000381098	0.645	Glutamate receptor-interacting protein 1
4	9606.ENSP00000401470	0.575	Ran GTPase-activating protein 1
5	9606.ENSP00000316032	0.541	Nuclear pore complex protein Nup98-Nup96
6	9606.ENSP00000290158	0.524	Importin subunit beta-1
7	9606.ENSP00000243938	0.513	WAP four-disulfide core domain containing
8	9606.ENSP00000362937	0.507	Regulator of chromosome condensation
9	9606.ENSP00000216214	0.505	Protein FAM118A
10	9606.ENSP00000310668	0.500	Nuclear pore complex protein Nup93

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.998	protein-containing complex binding
GO:0019789	0.997	SUMO transferase activity
GO:0031267	0.995	small GTPase binding
GO:0061659	0.975	ubiquitin-like protein ligase activity
GO:0061665	0.974	SUMO ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.954	cellular process
GO:0050896	0.913	response to stimulus
GO:0051179	0.881	localization
GO:0065007	0.836	biological regulation
GO:0051641	0.830	cellular localization
GO:0050789	0.811	regulation of biological process
GO:0051234	0.761	establishment of localization
GO:0050794	0.732	regulation of cellular process
GO:0006810	0.731	transport
GO:0051649	0.730	establishment of localization in cell
GO:0046907	0.696	intracellular transport
GO:0008152	0.603	metabolic process
GO:0051169	0.589	nuclear transport
GO:0071704	0.587	organic substance metabolic process
GO:0006913	0.579	nucleocytoplasmic transport
GO:0042221	0.577	response to chemical
GO:0010243	0.561	response to organonitrogen compound
GO:0043170	0.505	macromolecule metabolic process
GO:0033036	0.498	macromolecule localization
GO:0008104	0.450	protein localization
GO:0071702	0.427	organic substance transport
GO:0071705	0.422	nitrogen compound transport
GO:0019222	0.394	regulation of metabolic process
GO:0045184	0.349	establishment of protein localization
GO:0006886	0.343	intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005635	1.000	nuclear envelope
GO:0140513	0.999	nuclear protein-containing complex
GO:0005643	0.994	nuclear pore
GO:0031974	0.987	membrane-enclosed lumen
GO:0031981	0.982	nuclear lumen
GO:0005829	0.965	cytosol
GO:0016020	0.940	membrane
GO:0005654	0.922	nucleoplasm
GO:0044614	0.388	nuclear pore cytoplasmic filaments
GO:0042175	0.378	nuclear outer membrane-endoplasmic reticulum membrane network
GO:1902494	0.376	catalytic complex
GO:0016234	0.371	inclusion body
GO:0106068	0.371	SUMO ligase complex
GO:0005642	0.368	annulate lamellae
GO:0042405	0.356	nuclear inclusion body
GO:0044615	0.346	nuclear pore nuclear basket
GO:0048471	0.343	perinuclear region of cytoplasm
GO:0043232	0.327	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]