StarFunc result for job id Q7Z3K3

User Input

>input (1410 residues)
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHAS
VAGHLSTSTTVSSSGAQNSDSTKKTLVTLIANNNAGNPLVQQGGQPLILTQNPAPGLGTM
VTQPVLRPVQVMQNANHVTSSPVASQPIFITTQGFPVRNVRPVQNAMNQVGIVLNVQQGQ
TVRPITLVPAPGTQFVKPTVGVPQVFSQMTPVRPGSTMPVRPTTNTFTTVIPATLTIRST
VPQSQSQQTKSTPSTSTTPTATQPTSLGQLAVQSPGQSNQTTNPKLAPSFPSPPAVSIAS
FVTVKRPGVTGENSNEVAKLVNTLNTIPSLGQSPGPVVVSNNSSAHGSQRTSGPESSMKV
TSSIPVFDLQDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVEYQKKGKSLDSEPSVPSA
AKPPSPEKTAPVASTPSSTPIPALSPPTKVPEPNENVGDAVQTKLIMLVDDFYYGRDGGK
VAQLTNFPKVATSFRCPHCTKRLKNNIRFMNHMKHHVELDQQNGEVDGHTICQHCYRQFS
TPFQLQCHLENVHSPYESTTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSS
LYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNAFQQHYMRHQKRNVYHCNKCRLQFLFAK
DKIEHKLQHHKTFRKPKQLEGLKPGTKVTIRASRGQPRTVPVSSNDTPPSALQEAAPLTS
SMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYST
CCSRAYANHMINNHVPRKSPKYLALFKNSVSGIKLACTSCTFVTSVGDAMAKHLVFNPSH
RSSSILPRGLTWIAHSRHGQTRDRVHDRNVKNMYPPPSFPTNKAATVKSAGATPAEPEEL
LTPLAPALPSPASTATPPPTPTHPQALALPPLATEGAECLNVDDQDEGSPVTQEPELASG
GGGSGGVGKKEQLSVKKLRVVLFALCCNTEQAAEHFRNPQRRIRRWLRRFQASQGENLEG
KYLSFEAEEKLAEWVLTQREQQLPVNEETLFQKATKIGRSLEGGFKISYEWAVRFMLRHH
LTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLSMIVAIDEISLFLDTEVLSSD
DRKENALQTVGTGEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDSILLEAKESGYS
DDEIMELWSTRVWQKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSK
IQPLDVCIKRTVKNFLHKKWKEQAREMADTACDSDVLLQLVLVWLGEVLGVIGDCPELVQ
RSFLVASVLPGPDGNINSPTRNADMQEELIASLEEQLKLSGEHSESSTPRPRSSPEETIE
PESLHQLFEGESETESFYGFEEADLDLMEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3K3	1.000	1.000	0.000	1410	1.000	1.000	Q7Z3K3.pdb.gz	POGZ_HUMAN Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2
2	AFDB:Q8N1G0	0.055	0.061	6.451E-10	1237	0.133	0.151	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
3	AFDB:Q9VI93	0.052	0.068	7.122E-10	946	0.116	0.173	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
4	AFDB:A0A024RC04	0.055	0.083	4.223E-9	805	0.099	0.174	A0A024RC04.pdb.gz
5	AFDB:P20662	0.057	0.087	6.924E-9	777	0.087	0.157	P20662.pdb.gz	ZFY2_MOUSE Zinc finger Y-chromosomal protein 2 OS=Mus musculus OX=10090 GN=Zfy2 PE=2 SV=2
6	AFDB:Q9ULJ3	0.055	0.066	1.722E-7	1066	0.101	0.134	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
7	AFDB:Q92610	0.045	0.044	8.806E-7	1267	0.137	0.152	Q92610.pdb.gz	ZN592_HUMAN Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2
8	AFDB:F1Q833	0.038	0.049	7.541E-5	908	0.099	0.153	F1Q833.pdb.gz
9	AFDB:Q0KHR4	0.064	0.062	8.325E-5	1186	0.118	0.141	Q0KHR4.pdb.gz	Q0KHR4_DROME FI21203p1 OS=Drosophila melanogaster OX=7227 GN=mei-218 PE=2 SV=1
10	AFDB:A0A5K4F1D0	0.039	0.026	3.163E-4	2566	0.111	0.061	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
11	PDB:7pikC	0.064	0.132	9.301E-3	557	0.030	0.077	7pikC.pdb.gz	Structural basis of transposon end recognition explains central features of Tn7 transposition systems.
12	PDB:3ngyC	0.062	0.272	1.411E-1	182	0.018	0.137	3ngyC.pdb.gz	Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
13	PDB:5z56A	0.075	0.053	1.558E-1	2232	0.028	0.017	5z56A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
14	PDB:3w5kB	0.044	0.239	1.637E-1	110	0.022	0.282	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
15	PDB:5o9zH	0.058	0.150	2.202E-1	413	0.025	0.085	5o9zH.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
16	PDB:6v93A	0.084	0.090	2.314E-1	1259	0.021	0.024	6v93A.pdb.gz	Structure and mechanism of B-family DNA polymerase zeta specialized for translesion DNA synthesis.
17	PDB:7q5bB	0.083	0.213	2.554E-1	482	0.022	0.064	7q5bB.pdb.gz	Structural basis of Ty3 retrotransposon integration at RNA Polymerase III-transcribed genes.
18	PDB:6iczA	0.077	0.053	2.963E-1	2253	0.029	0.018	6iczA.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
19	PDB:5mc1B	0.067	0.146	3.436E-1	485	0.018	0.054	5mc1B.pdb.gz	Structural basis for prolidase deficiency disease mechanisms.
20	PDB:4xguB	0.049	0.117	3.610E-1	382	0.019	0.071	4xguB.pdb.gz	TRIP13 is a protein-remodeling AAA+ ATPase that catalyzes MAD2 conformation switching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8E7N7	0.0	662	1277	0.340	0.376	A8E7N7_DANRE Pogo transposable element-derived with ZNF domain a OS=Danio rerio OX=7955 GN=im:7136628 PE=1 SV=1
2	Q7Z3K3	0.0	2926	1410	1.000	1.000	POGZ_HUMAN Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2
3	Q6N043	3.63e-135	443	979	0.166	0.239	Z280D_HUMAN Zinc finger protein 280D OS=Homo sapiens OX=9606 GN=ZNF280D PE=1 SV=3
4	Q8ND82	9.54e-123	402	737	0.170	0.326	Z280C_HUMAN Zinc finger protein 280C OS=Homo sapiens OX=9606 GN=ZNF280C PE=1 SV=1
5	P59817	6.65e-70	247	542	0.089	0.231	Z280A_HUMAN Zinc finger protein 280A OS=Homo sapiens OX=9606 GN=ZNF280A PE=1 SV=4
6	Q9P215	4.59e-24	111	609	0.074	0.172	POGK_HUMAN Pogo transposable element with KRAB domain OS=Homo sapiens OX=9606 GN=POGK PE=1 SV=2
7	Q5U156	5.72e-24	112	1281	0.071	0.078	Q5U156_DROME RE01954p OS=Drosophila melanogaster OX=7227 GN=row PE=1 SV=1
8	A0A0B4KER0	5.92e-24	112	1301	0.071	0.077	A0A0B4KER0_DROME Relative of woc, isoform C OS=Drosophila melanogaster OX=7227 GN=row PE=1 SV=1
9	Q960P7	2.55e-22	105	587	0.074	0.177	Q960P7_DROME LD41072p OS=Drosophila melanogaster OX=7227 GN=row PE=2 SV=1
10	Q60821	5.19e-14	79.7	794	0.042	0.074	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
11	Q13105	1.88e-13	77.8	803	0.044	0.077	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
12	Q9VR05	3.58e-13	75.1	346	0.038	0.156	PARIS_DROME Zinc finger protein Paris OS=Drosophila melanogaster OX=7227 GN=Paris PE=1 SV=2
13	A0A1W2PQA1	4.18e-11	70.5	1069	0.036	0.048	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
14	P08155	9.50e-11	68.9	845	0.040	0.067	KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster OX=7227 GN=Kr-h1 PE=2 SV=2
15	P47043	3.94e-10	67.0	880	0.032	0.051	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
16	Q8VIG1	4.03e-10	67.0	1082	0.035	0.046	REST_MOUSE RE1-silencing transcription factor OS=Mus musculus OX=10090 GN=Rest PE=1 SV=2
17	Q3UT31	4.73e-10	65.1	312	0.038	0.173	Q3UT31_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Platr25 PE=2 SV=1
18	Q8BLE1	5.09e-10	65.1	338	0.038	0.160	Q8BLE1_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
19	A0A1Y7VLS7	5.72e-10	64.7	312	0.038	0.173	A0A1Y7VLS7_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
20	Q9VIS9	6.06e-10	66.2	578	0.036	0.088	Q9VIS9_DROME Zinc finger protein weckle OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10366 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03184 DDE_1	2.5e-07	42.1	DDE superfamily endonuclease
2	PF13358 DDE_3	2e+02	13.2	DDE superfamily endonuclease
3	PF13384 HTH_23	1.5e+02	13.7	Homeodomain-like domain
4	PF13518 HTH_28	66	15.0	Helix-turn-helix domain
5	PF03221 HTH_Tnp_Tc5	7.7e-06	37.2	Tc5 transposase DNA-binding domain
6	PF13894 zf-C2H2_4	0.016	27.0	C2H2-type zinc finger
7	PF11781 zf-RRN7	33	15.6	Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271715

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354730	0.970	Chromosome alignment-maintaining phosphoprotein 1
2	9606.ENSP00000377060	0.961	Chromobox protein homolog 1
3	9606.ENSP00000370109	0.955	PC4 and SFRS1-interacting protein
4	9606.ENSP00000209875	0.917	Chromobox protein homolog 5
5	9606.ENSP00000235310	0.890	Mitotic spindle assembly checkpoint protein MAD2B
6	9606.ENSP00000382863	0.837	Chromodomain-helicase-DNA-binding protein 8
7	9606.ENSP00000336687	0.820	Chromobox protein homolog 3
8	9606.ENSP00000383986	0.796	Cell division cycle-associated 7-like protein
9	9606.ENSP00000322915	0.758	Zinc finger MYM-type protein 4
10	9606.ENSP00000379346	0.757	Activity-dependent neuroprotector homeobox protein
11	9606.ENSP00000322845	0.732	Zinc finger MYM-type protein 3
12	9606.ENSP00000245121	0.723	Katanin p60 ATPase-containing subunit A-like 2
13	9606.ENSP00000483345	0.717	Hepatoma-derived growth factor-related protein 2
14	9606.ENSP00000479904	0.693	Zinc finger MYM-type protein 2
15	9606.ENSP00000364586	0.664	Sodium channel protein type 2 subunit alpha
16	9606.ENSP00000381932	0.659	Dual specificity tyrosine-phosphorylation-regulated kinase 1A
17	9606.ENSP00000343552	0.621	Protein-S-isoprenylcysteine O-methyltransferase
18	9606.ENSP00000362649	0.619	Histone deacetylase 1
19	9606.ENSP00000393139	0.613	Cell division cycle 7-related protein kinase
20	9606.ENSP00000364678	0.605	Histone-lysine N-methyltransferase EHMT2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.489	nucleic acid binding
GO:0003677	0.480	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0016043	0.980	cellular component organization
GO:0051171	0.967	regulation of nitrogen compound metabolic process
GO:0048518	0.948	positive regulation of biological process
GO:0019219	0.946	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.938	positive regulation of cellular process
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0010604	0.928	positive regulation of macromolecule metabolic process
GO:0045935	0.921	positive regulation of nucleobase-containing compound metabolic process
GO:0006996	0.805	organelle organization
GO:0043933	0.741	protein-containing complex organization
GO:0051276	0.712	chromosome organization
GO:0007049	0.710	cell cycle
GO:0071824	0.707	protein-DNA complex subunit organization
GO:0065004	0.662	protein-DNA complex assembly
GO:0034508	0.588	centromere complex assembly
GO:0048583	0.531	regulation of response to stimulus
GO:0010468	0.458	regulation of gene expression
GO:0051383	0.442	kinetochore organization
GO:0022402	0.418	cell cycle process
GO:0051252	0.377	regulation of RNA metabolic process
GO:0051052	0.376	regulation of DNA metabolic process
GO:0080135	0.375	regulation of cellular response to stress
GO:1903047	0.359	mitotic cell cycle process
GO:0048584	0.351	positive regulation of response to stimulus
GO:2001020	0.349	regulation of response to DNA damage stimulus
GO:0048285	0.336	organelle fission
GO:0007059	0.331	chromosome segregation
GO:0048519	0.312	negative regulation of biological process
GO:0048523	0.303	negative regulation of cellular process
GO:0006355	0.303	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0005694	0.991	chromosome
GO:0000785	0.974	chromatin
GO:0032991	0.461	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]