StarFunc result for job id Q7Z3K6

User Input

>input (550 residues)
MAEASFGSSSPVGSLSSEDHDFDPTAEMLVHDYDDERTLEEEEMMDEGKNFSSEIEDLEK
EGTMPLEDLLAFYGYEPTIPAVANSSANSSPSELADELPDMTLDKEEIAKDLLSGDDEET
QSSADDLTPSVTSHETSDFFPRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGL
QYQAEIPPYLGEYDGNEKVYENEDQLLWCPDVVLESKVKEYLVETSLRTGSEKIMDRISA
GTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQEGMTAWTEEECRSFEHALMLFGKD
FHLIQKNKVRTRTVAECVAFYYMWKKSERYDYFAQQTRFGKKRYNHHPGVTDYMDRLVDE
TEALGGTVNASALTSNRPEPIPDQQLNILNSFTASDLTALTNSVATVCDPTDVNCLDDSF
PPLGNTPRGQVNHVPVVTEELLTLPSNGESDCFNLFETGFYHSELNPMNMCSEESERPAK
RLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFISAHA
LHQHAALHSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3K6	0.999	0.999	1.019E-76	550	1.000	1.000	Q7Z3K6.pdb.gz	MIER3_HUMAN Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3 PE=1 SV=2
2	AFDB:Q8N108	0.385	0.409	9.206E-30	512	0.420	0.451	Q8N108.pdb.gz	MIER1_HUMAN Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 PE=1 SV=2
3	AFDB:Q8N344	0.306	0.309	1.532E-25	545	0.375	0.378	Q8N344.pdb.gz	MIER2_HUMAN Mesoderm induction early response protein 2 OS=Homo sapiens OX=9606 GN=MIER2 PE=1 SV=2
4	PDB:7aoaD	0.244	0.378	2.184E-6	343	0.093	0.149	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
5	AFDB:A0A1D8PSN1	0.077	0.061	5.482E-4	750	0.111	0.081	A0A1D8PSN1.pdb.gz	A0A1D8PSN1_CANAL Transcription initiation factor TFIID subunit 12 domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TAF12L PE=3 SV=1
6	AFDB:O57602	0.104	0.095	6.146E-4	623	0.136	0.120	O57602.pdb.gz	O57602_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct1 PE=2 SV=1
7	AFDB:Q59T43	0.108	0.099	4.294E-3	607	0.138	0.125	Q59T43.pdb.gz	Q59T43_CANAL Myb-like DNA-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C205640WA PE=4 SV=1
8	AFDB:Q8ND83	0.073	0.071	1.012E-2	568	0.162	0.157	Q8ND83.pdb.gz	SLAI1_HUMAN SLAIN motif-containing protein 1 OS=Homo sapiens OX=9606 GN=SLAIN1 PE=1 SV=3
9	AFDB:Q0GGX2	0.249	0.113	1.347E-2	1363	0.147	0.059	Q0GGX2.pdb.gz	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
10	AFDB:M9PHT1	0.209	0.069	2.254E-2	2007	0.120	0.033	M9PHT1.pdb.gz	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
11	AFDB:O14647	0.068	0.029	2.833E-2	1828	0.124	0.037	O14647.pdb.gz	CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2
12	PDB:5z56L	0.087	0.135	3.849E-2	342	0.051	0.082	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
13	PDB:6id0L	0.089	0.101	1.208E-1	475	0.051	0.059	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
14	PDB:6qdvO	0.085	0.105	1.434E-1	441	0.055	0.068	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
15	PDB:5l3cB	0.096	0.366	1.908E-1	134	0.040	0.164	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
16	PDB:7c4jB	0.087	0.114	1.908E-1	395	0.060	0.084	7c4jB.pdb.gz
17	PDB:4czzB	0.098	0.366	2.020E-1	133	0.040	0.165	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
18	PDB:5yzgL	0.082	0.100	2.020E-1	419	0.060	0.079	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:6iczL	0.087	0.101	2.847E-1	454	0.047	0.057	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:6lthO	0.093	0.145	4.498E-1	325	0.045	0.077	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3K6	0.0	1144	550	1.000	1.000	MIER3_HUMAN Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3 PE=1 SV=2
2	Q8N108	2.20e-120	366	512	0.387	0.416	MIER1_HUMAN Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 PE=1 SV=2
3	Q8N344	1.40e-97	308	545	0.391	0.394	MIER2_HUMAN Mesoderm induction early response protein 2 OS=Homo sapiens OX=9606 GN=MIER2 PE=1 SV=2
4	Q7SXR7	3.15e-13	74.7	631	0.096	0.084	Q7SXR7_DANRE Metastasis associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fi29g02 PE=1 SV=1
5	F1QLG2	3.71e-13	74.7	663	0.096	0.080	F1QLG2_DANRE Metastasis-associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fd61b05 PE=1 SV=2
6	Q9R190	7.14e-12	70.5	668	0.091	0.075	MTA2_MOUSE Metastasis-associated protein MTA2 OS=Mus musculus OX=10090 GN=Mta2 PE=1 SV=1
7	O94776	7.79e-12	70.5	668	0.093	0.076	MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1
8	B2GV01	8.73e-12	70.1	668	0.091	0.075	B2GV01_RAT Metastasis-associated gene family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
9	F7F888	1.50e-11	69.3	670	0.085	0.070	F7F888_RAT Metastasis associated 1 family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
10	Q6PGA0	3.95e-11	67.8	451	0.104	0.126	RCOR3_MOUSE REST corepressor 3 OS=Mus musculus OX=10090 GN=Rcor3 PE=1 SV=2
11	Q05GC8	6.36e-11	67.8	1220	0.102	0.046	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
12	Q96PN7	7.52e-11	67.4	1200	0.102	0.047	TREF1_HUMAN Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
13	A0A0B4KG70	1.08e-10	67.0	922	0.087	0.052	A0A0B4KG70_DROME Metastasis associated 1-like, isoform D OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=1
14	Q9H0D2	1.11e-10	67.0	1346	0.095	0.039	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
15	B7Z0T5	1.22e-10	66.6	853	0.087	0.056	B7Z0T5_DROME Metastasis associated 1-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=1
16	Q6AWS2	1.27e-10	66.6	857	0.087	0.056	Q6AWS2_DROME SD15071p OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=2 SV=1
17	Q9U6X3	1.46e-10	66.6	841	0.087	0.057	Q9U6X3_DROME LD04853p (Fragment) OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=2 SV=1
18	Q9VNF6	1.48e-10	66.6	880	0.087	0.055	Q9VNF6_DROME Metastasis associated 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=2
19	Q9VNF7	1.51e-10	66.2	844	0.087	0.057	Q9VNF7_DROME Metastasis associated 1-like, isoform B OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=2
20	Q0GGX2	2.26e-10	66.2	1363	0.115	0.046	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01448 ELM2	2.3e-05	36.4	ELM2 domain
2	PF03127 GAT	47	15.7	GAT domain
3	PF19426 MIER1_3_C	2.3e-118	405.2	Mesoderm induction early response protein 1/3 C-terminal
4	PF00249 Myb_DNA-binding	0.42	22.2	Myb-like DNA-binding domain
5	PF15963 Myb_DNA-bind_7	7	17.9	Myb DNA-binding like
6	PF11577 NEMO	4.2e+02	12.3	NF-kappa-B essential modulator NEMO

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.844	Histone deacetylase 1
2	9606.ENSP00000274376	0.817	Ras GTPase-activating protein 1
3	9606.ENSP00000383042	0.709	Lysine-specific histone demethylase 1A
4	9606.ENSP00000285947	0.685	SET domain containing 9
5	9606.ENSP00000285697	0.684	UPF0547 protein C16orf87
6	9606.ENSP00000483667	0.676	Chromodomain-helicase-DNA-binding protein 1
7	9606.ENSP00000380759	0.548	Protein arginine N-methyltransferase 2
8	9606.ENSP00000424328	0.541	Mitochondrial ribosomal protein S30
9	9606.ENSP00000366953	0.534	DDB1- and CUL4-associated factor 10
10	9606.ENSP00000396976	0.522	Bromo adjacent homology domain-containing 1 protein
11	9606.ENSP00000380157	0.519	Molybdopterin synthase catalytic subunit
12	9606.ENSP00000368007	0.510	Transmembrane protein 240

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.705	enzyme binding
GO:0003824	0.458	catalytic activity
GO:0140110	0.367	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.970	biological regulation
GO:0050789	0.953	regulation of biological process
GO:0071704	0.929	organic substance metabolic process
GO:0050794	0.924	regulation of cellular process
GO:0044238	0.919	primary metabolic process
GO:0016570	0.907	histone modification
GO:0098732	0.892	macromolecule deacylation
GO:0009987	0.866	cellular process
GO:0019222	0.713	regulation of metabolic process
GO:0006476	0.702	protein deacetylation
GO:0060255	0.693	regulation of macromolecule metabolic process
GO:0016575	0.688	histone deacetylation
GO:0080090	0.594	regulation of primary metabolic process
GO:0031323	0.576	regulation of cellular metabolic process
GO:0051171	0.502	regulation of nitrogen compound metabolic process
GO:0009889	0.350	regulation of biosynthetic process
GO:0019219	0.344	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.338	regulation of cellular biosynthetic process
GO:0010468	0.311	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0005737	0.698	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]