StarFunc result for job id Q7Z3S7

User Input

>input (1137 residues)
MVCGCSALLPLPNPRPTMPATPNFLANPSSSSRWIPLQPMPVAWAFVQKTSALLWLLLLG
TSLSPAWGQAKIPLETVKLWADTFGGDLYNTVTKYSGSLLLQKKYKDVESSLKIEEVDGL
ELVRKFSEDMENMLRRKVEAVQNLVEAAEEADLNHEFNESLVFDYYNSVLINERDEKGNF
VELGAEFLLESNAHFSNLPVNTSISSVQLPTNVYNKDPDILNGVYMSEALNAVFVENFQR
DPTLTWQYFGSATGFFRIYPGIKWTPDENGVITFDCRNRGWYIQAATSPKDIVILVDVSG
SMKGLRMTIAKHTITTILDTLGENDFINIIAYNDYVHYIEPCFKGILVQADRDNREHFKL
LVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLCNQAIMLISDGAVEDYEPVFEKYNW
PDCKVRVFTYLIGREVSFADRMKWIACNNKGYYTQISTLADTQENVMEYLHVLSRPMVIN
HDHDIIWTEAYMDSKLLSSQAQSLTLLTTVAMPVFSKKNETRSHGILLGVVGSDVALREL
MKLAPRYKLGVHGYAFLNTNNGYILSHPDLRPLYREGKKLKPKPNYNSVDLSEVEWEDQA
ESLRTAMINRETGTLSMDVKVPMDKGKRVLFLTNDYFFTDISDTPFSLGVVLSRGHGEYI
LLGNTSVEEGLHDLLHPDLALAGDWIYCITDIDPDHRKLSQLEAMIRFLTRKDPDLECDE
ELVREVLFDAVVTAPMEAYWTALALNMSEESEHVVDMAFLGTRAGLLRSSLFVGSEKVSD
RKFLTPEDEASVFTLDRFPLWYRQASEHPAGSFVFNLRWAEGPESAGEPMVVTASTAVAV
TVDKRTAIAAAAGVQMKLEFLQRKFWAATRQCSTVDGPCTQSCEDSDLDCFVIDNNGFIL
ISKRSRETGRFLGEVDGAVLTQLLSMGVFSQVTMYDYQAMCKPSSHHHSAAQPLVSPISA
FLTATRWLLQELVLFLLEWSVWGSWYDRGAEAKSVFHHSHKHKKQDPLQPCDTEYPVFVY
QPAIREANGIVECGPCQKVFVVQQIPNSNLLLLVTDPTCDCSIFPPVLQEATEVKYNASV
KCDRMRSQKLRRRPDSCHAFHPEENAQDCGGASDTSASPPLLLLPVCAWGLLPQLLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QYJ5	0.899	0.940	0.000	1087	0.578	0.604	F1QYJ5.pdb.gz
2	AFDB:Q7Z3S7	1.000	1.000	0.000	1137	1.000	1.000	Q7Z3S7.pdb.gz	CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens OX=9606 GN=CACNA2D4 PE=1 SV=2
3	AFDB:Q8CFG5	0.905	0.948	0.000	1085	0.564	0.591	Q8CFG5.pdb.gz	CA2D3_RAT Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus OX=10116 GN=Cacna2d3 PE=1 SV=1
4	AFDB:Q8IP22	0.813	0.763	3.985E-92	1215	0.325	0.305	Q8IP22.pdb.gz	Q8IP22_DROME Ca[2+] channel Muscle-specific alpha2/delta subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=Ca-Ma2d PE=2 SV=2
5	AFDB:A0A0B4K7P4	0.780	0.719	3.009E-91	1237	0.337	0.310	A0A0B4K7P4.pdb.gz	A0A0B4K7P4_DROME Straightjacket, isoform D OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
6	AFDB:A0A0B4K866	0.767	0.689	5.099E-90	1271	0.329	0.294	A0A0B4K866.pdb.gz	A0A0B4K866_DROME Straightjacket, isoform C OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
7	AFDB:X2J9Z3	0.789	0.709	1.196E-87	1271	0.302	0.270	X2J9Z3.pdb.gz	X2J9Z3_DROME Stolid, isoform H OS=Drosophila melanogaster OX=7227 GN=stol PE=1 SV=1
8	AFDB:Q8CFG6	0.749	0.737	7.287E-83	1157	0.287	0.282	Q8CFG6.pdb.gz	CA2D2_RAT Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Rattus norvegicus OX=10116 GN=Cacna2d2 PE=2 SV=1
9	AFDB:P13806	0.729	0.748	5.750E-80	1106	0.273	0.280	P13806.pdb.gz	CA2D1_RABIT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNA2D1 PE=1 SV=1
10	AFDB:E7F4T2	0.735	0.763	5.314E-79	1091	0.263	0.274	E7F4T2.pdb.gz	E7F4T2_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
11	PDB:6jp8F	0.716	0.828	1.517E-71	973	0.253	0.296	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
12	PDB:6sn1B	0.132	0.269	3.486E-6	503	0.028	0.064	6sn1B.pdb.gz
13	PDB:6zheC	0.126	0.189	1.944E-5	705	0.065	0.105	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
14	PDB:7ad8D	0.133	0.491	2.150E-5	280	0.024	0.096	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
15	PDB:2xwbF	0.129	0.198	2.262E-5	714	0.036	0.057	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
16	PDB:5y58B	0.103	0.188	2.632E-5	568	0.037	0.074	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
17	PDB:1m2vA	0.125	0.188	3.222E-5	705	0.066	0.106	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
18	PDB:7k0yC	0.129	0.210	3.389E-5	655	0.058	0.101	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
19	PDB:6gym6	0.134	0.410	3.564E-5	335	0.017	0.057	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
20	PDB:4nehA	0.132	0.138	6.537E-5	1084	0.047	0.050	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3S7	0.0	2370	1137	1.000	1.000	CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens OX=9606 GN=CACNA2D4 PE=1 SV=2
2	Q8CFG5	0.0	1382	1085	0.554	0.581	CA2D3_RAT Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus OX=10116 GN=Cacna2d3 PE=1 SV=1
3	Q7K0H4	2.02e-177	555	1218	0.354	0.330	Q7K0H4_DROME SD07723p OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
4	A0A0B4K7P4	2.48e-174	548	1237	0.356	0.327	A0A0B4K7P4_DROME Straightjacket, isoform D OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
5	A0A0B4K866	2.22e-170	538	1271	0.359	0.321	A0A0B4K866_DROME Straightjacket, isoform C OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
6	Q8IP22	1.13e-164	521	1215	0.348	0.326	Q8IP22_DROME Ca[2+] channel Muscle-specific alpha2/delta subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=Ca-Ma2d PE=2 SV=2
7	Q8CFG6	1.24e-133	437	1157	0.295	0.290	CA2D2_RAT Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Rattus norvegicus OX=10116 GN=Cacna2d2 PE=2 SV=1
8	Q6PHS9	1.29e-132	434	1154	0.295	0.290	CA2D2_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Mus musculus OX=10090 GN=Cacna2d2 PE=1 SV=1
9	Q9NY47	4.20e-132	433	1150	0.292	0.289	CA2D2_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Homo sapiens OX=9606 GN=CACNA2D2 PE=1 SV=2
10	P13806	1.59e-122	406	1106	0.282	0.290	CA2D1_RABIT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNA2D1 PE=1 SV=1
11	P54289	7.27e-120	399	1103	0.282	0.291	CA2D1_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Homo sapiens OX=9606 GN=CACNA2D1 PE=1 SV=3
12	O08532	1.05e-119	398	1103	0.272	0.280	CA2D1_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Mus musculus OX=10090 GN=Cacna2d1 PE=1 SV=1
13	X2J9Z3	4.27e-116	392	1271	0.193	0.172	X2J9Z3_DROME Stolid, isoform H OS=Drosophila melanogaster OX=7227 GN=stol PE=1 SV=1
14	Q5TZ68	2.43e-113	380	1069	0.260	0.277	Q5TZ68_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
15	P54290	2.43e-112	378	1091	0.266	0.278	CA2D1_RAT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Rattus norvegicus OX=10116 GN=Cacna2d1 PE=1 SV=1
16	E7F4T2	2.60e-111	375	1091	0.262	0.273	E7F4T2_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
17	Q95R75	7.21e-96	327	842	0.231	0.312	Q95R75_DROME SD03196p OS=Drosophila melanogaster OX=7227 GN=stj PE=2 SV=1
18	G4S4A1	3.74e-61	231	1205	0.185	0.174	G4S4A1_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=1
19	P34374	8.85e-57	217	1249	0.186	0.170	UNC36_CAEEL Voltage-dependent calcium channel unc-36 OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=2
20	Q61703	5.05e-09	63.2	946	0.049	0.059	ITIH2_MOUSE Inter-alpha-trypsin inhibitor heavy chain H2 OS=Mus musculus OX=10090 GN=Itih2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11775 CobT_C	3.7e+02	12.1	Cobalamin biosynthesis protein CobT VWA domain
2	PF02743 dCache_1	1.4e-05	36.3	Cache domain
3	PF08473 VGCC_alpha2	1.6e-36	137.7	Neuronal voltage-dependent calcium channel alpha 2acd
4	PF00092 VWA	1.2e-05	37.1	von Willebrand factor type A domain
5	PF13519 VWA_2	3.5e-05	35.8	von Willebrand factor type A domain
6	PF13768 VWA_3	3.9e-12	57.8	von Willebrand factor type A domain
7	PF05762 VWA_CoxE	81	14.0	VWA domain containing CoxE-like protein
8	PF08399 VWA_N	1.1e-34	131.0	VWA N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000372169

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301050	0.984	Voltage-dependent L-type calcium channel subunit beta-3
2	9606.ENSP00000365441	0.984	Voltage-dependent L-type calcium channel subunit alpha-1F
3	9606.ENSP00000438949	0.982	Voltage-dependent L-type calcium channel subunit beta-4
4	9606.ENSP00000266376	0.972	Voltage-dependent L-type calcium channel subunit alpha-1C
5	9606.ENSP00000288139	0.963	Voltage-dependent L-type calcium channel subunit alpha-1D
6	9606.ENSP00000355192	0.963	Voltage-dependent L-type calcium channel subunit alpha-1S
7	9606.ENSP00000226021	0.962	Voltage-dependent calcium channel gamma-1 subunit
8	9606.ENSP00000320025	0.946	Voltage-dependent L-type calcium channel subunit beta-2
9	9606.ENSP00000262138	0.936	Voltage-dependent calcium channel gamma-4 subunit
10	9606.ENSP00000377840	0.932	Voltage-dependent L-type calcium channel subunit beta-1
11	9606.ENSP00000375647	0.931	Voltage-dependent calcium channel gamma-7 subunit
12	9606.ENSP00000349320	0.930	Voltage-dependent calcium channel subunit alpha-2/delta-1
13	9606.ENSP00000005284	0.921	Voltage-dependent calcium channel gamma-3 subunit
14	9606.ENSP00000270458	0.915	Voltage-dependent calcium channel gamma-8 subunit
15	9606.ENSP00000356545	0.903	Voltage-dependent R-type calcium channel subunit alpha-1E
16	9606.ENSP00000252729	0.902	Voltage-dependent calcium channel gamma-6 subunit
17	9606.ENSP00000360423	0.897	Voltage-dependent N-type calcium channel subunit alpha-1B
18	9606.ENSP00000353362	0.864	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
19	9606.ENSP00000334198	0.860	Voltage-dependent T-type calcium channel subunit alpha-1H
20	9606.ENSP00000309052	0.799	Cation channel sperm-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005245	0.999	voltage-gated calcium channel activity
GO:0098772	0.933	molecular function regulator activity
GO:0005246	0.865	calcium channel regulator activity
GO:0005515	0.828	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0032501	0.969	multicellular organismal process
GO:0006812	0.939	monoatomic cation transport
GO:0006816	0.931	calcium ion transport
GO:0050896	0.912	response to stimulus
GO:0050953	0.857	sensory perception of light stimulus
GO:0007601	0.819	visual perception
GO:0070588	0.710	calcium ion transmembrane transport
GO:0009583	0.663	detection of light stimulus
GO:0050906	0.578	detection of stimulus involved in sensory perception
GO:0065007	0.575	biological regulation
GO:0050962	0.563	detection of light stimulus involved in sensory perception
GO:0009584	0.562	detection of visible light
GO:0050789	0.545	regulation of biological process
GO:0050908	0.540	detection of light stimulus involved in visual perception
GO:0050794	0.440	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.998	protein-containing complex
GO:0034704	0.987	calcium channel complex
GO:0098797	0.985	plasma membrane protein complex
GO:0005891	0.973	voltage-gated calcium channel complex
GO:0005622	0.711	intracellular anatomical structure
GO:0043226	0.684	organelle
GO:0005737	0.683	cytoplasm
GO:0043227	0.670	membrane-bounded organelle
GO:0043229	0.470	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.999	Ca(2+)(in) = Ca(2+)(out)

[back to server]