StarFunc result for job id Q7Z3T8

User Input

>input (1539 residues)
MDSYFKAAVSDLDKLLDDFEQNPDEQDYLQDVQNAYDSNHCSVSSELASSQRTSLLPKDQ
ECVNSCASSETSYGTNESSLNEKTLKGLTSIQNEKNVTGLDLLSSVDGGTSDEIQPLYMG
RCSKPICDLISDMGNLVHATNSEEDIKKLLPDDFKSNADSLIGLDLSSVSDTPCVSSTDH
DSDTVREQQNDISSELQNREIGGIKELGIKVDTTLSDSYNYSGTENLKDKKIFNQLESIV
DFNMSSALTRQSSKMFHAKDKLQHKSQPCGLLKDVGLVKEEVDVAVITAAECLKEEGKTS
ALTCSLPKNEDLCLNDSNSRDENFKLPDFSFQEDKTVIKQSAQEDSKSLDLKDNDVIQDS
SSALHVSSKDVPSSLSCLPASGSMCGSLIESKARGDFLPQHEHKDNIQDAVTIHEEIQNS
VVLGGEPFKENDLLKQEKCKSILLQSLIEGMEDRKIDPDQTVIRAESLDGGDTSSTVVES
QEGLSGTHVPESSDCCEGFINTFSSNDMDGQDLDYFNIDEGAKSGPLISDAELDAFLTEQ
YLQTTNIKSFEENVNDSKSQMNQIDMKGLDDGNINNIYFNAEAGAIGESHGINIICEIVD
KQNTIENGLSLGEKSTIPVQQGLPTSKSEITNQLSVSDINSQSVGGARPKQLFSLPSRTR
SSKDLNKPDVPDTIESEPSTADTVVPITCAIDSTADPQVSFNSNYIDIESNSEGGSSFVT
ANEDSVPENTCKEGLVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVC
CNRKCKLQYLEKEARVCVVCYETISKAQAFERMMSPTGSNLKSNHSDECTTVQPPQENQT
SSIPSPATLPVSALKQPGVEGLCSKEQKRVWFADGILPNGEVADTTKLSSGSKRCSEDFS
PLSPDVPMTVNTVDHSHSTTVEKPNNETGDITRNEIIQSPISQVPSVEKLSMNTGNEGLP
TSGSFTLDDDVFAETEEPSSPTGVLVNSNLPIASISDYRLLCDINKYVCNKISLLPNDED
SLPPLLVASGEKGSVPVVEEHPSHEQIILLLEGESFHPVTFVLNANLLVNVKFIFYSSDK
YWYFSTNGLHGLGQAEIIILLLCLPNEDTIPKDIFRLFITIYKDALKGKYIENLDNITFT
ESFLSSKDHGGFLFITPTFQKLDDLSLPSNPFLCGILIQKLEIPWAKVFPMRLMLRLGAE
YKAYPAPLTSIRGRKPLFGEIGHTIMNLLVDLRNYQYTLHNIDQLLIHMEMGKSCIKIPR
KKYSDVMKVLNSSNEHVISIGASFSTEADSHLVCIQNDGIYETQANSATGHPRKVTGASF
VVFNGALKTSSGFLAKSSIVEDGLMVQITPETMNGLRLALREQKDFKITCGKVDAVDLRE
YVDICWVDAEEKGNKGVISSVDGISLQGFPSEKIKLEADFETDEKIVKCTEVFYFLKDQD
LSILSTSYQFAKEIAMACSAALCPHLKTLKSNGMNKIGLRVSIDTDMVEFQAGSEGQLLP
QHYLNDLDSALIPVIHGGTSNSSLPLEIELVFFIIEHLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3T8	1.000	1.000	0.000	1539	1.000	1.000	Q7Z3T8.pdb.gz	ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3
2	AFDB:A2A8R0	0.363	0.398	8.907E-100	1397	0.328	0.361	A2A8R0.pdb.gz	A2A8R0_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
3	PDB:4blaD	0.095	0.183	4.493E-8	738	0.025	0.053	4blaD.pdb.gz
4	PDB:4kmaA	0.095	0.284	6.973E-6	440	0.027	0.093	4kmaA.pdb.gz
5	AFDB:Q9SIV5	0.050	0.046	9.221E-6	1773	0.105	0.091	Q9SIV5.pdb.gz	C3H19_ARATH Zinc finger CCCH domain-containing protein 19 OS=Arabidopsis thaliana OX=3702 GN=NERD PE=1 SV=3
6	AFDB:M0RDF1	0.040	0.038	1.474E-4	1724	0.097	0.086	M0RDF1.pdb.gz	M0RDF1_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=2
7	PDB:7elmE	0.037	0.125	1.241E-2	337	0.013	0.059	7elmE.pdb.gz	Insights into the inhibition of type I-F CRISPR-Cas system by a multifunctional anti-CRISPR protein AcrIF24.
8	PDB:7eqgD	0.038	0.130	1.637E-2	309	0.012	0.061	7eqgD.pdb.gz	AcrIF5 specifically targets DNA-bound CRISPR-Cas surveillance complex for inhibition.
9	AFDB:Q9UMD9	0.033	0.033	1.734E-2	1497	0.093	0.096	Q9UMD9.pdb.gz	COHA1_HUMAN Collagen alpha-1(XVII) chain OS=Homo sapiens OX=9606 GN=COL17A1 PE=1 SV=3
10	AFDB:H2KYH3	0.026	0.020	2.556E-2	2476	0.102	0.063	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
11	AFDB:Q583D6	0.039	0.039	3.019E-2	1471	0.105	0.110	Q583D6.pdb.gz	Q583D6_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.880 PE=3 SV=1
12	AFDB:Q9LYD9	0.030	0.036	3.019E-2	1096	0.096	0.135	Q9LYD9.pdb.gz	EMF1_ARATH Protein EMBRYONIC FLOWER 1 OS=Arabidopsis thaliana OX=3702 GN=EMF1 PE=1 SV=1
13	AFDB:A0A1C7CYX1	0.030	0.036	3.565E-2	1099	0.093	0.130	A0A1C7CYX1.pdb.gz	A0A1C7CYX1_HUMAN Mitotic deacetylase associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=1
14	AFDB:Q924C5	0.050	0.046	3.565E-2	1678	0.115	0.105	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
15	PDB:6vqvE	0.036	0.115	5.542E-2	285	0.013	0.070	6vqvE.pdb.gz	Inhibition mechanisms of AcrF9, AcrF8, and AcrF6 against type I-F CRISPR-Cas complex revealed by cryo-EM.
16	PDB:5svcB	0.043	0.074	1.346E-1	710	0.010	0.023	5svcB.pdb.gz	Structural Basis for the Mechanism of ATP-Dependent Acetone Carboxylation.
17	PDB:5f0jB	0.031	0.093	2.216E-1	306	0.014	0.069	5f0jB.pdb.gz
18	PDB:7nv0A	0.040	0.105	2.216E-1	430	0.006	0.023	7nv0A.pdb.gz	Cryo-EM structure of human Pol kappa bound to DNA and mono-ubiquitylated PCNA.
19	PDB:7ypbC	0.028	0.032	2.924E-1	1292	0.021	0.025	7ypbC.pdb.gz	Structural basis for intrinsic transcription termination.
20	PDB:2m5cA	0.036	0.152	3.858E-1	227	0.007	0.048	2m5cA.pdb.gz	Solution structures of the Bacillus cereus metallo-beta-lactamase BcII and its complex with the broad spectrum inhibitor R-thiomandelic acid.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0S860	0.0	643	706	0.229	0.500	A0S860_MOUSE Zinc finger FYVE domain-containing protein 9 splice variant Z2.1 OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
2	A2A8R0	0.0	724	1397	0.248	0.273	A2A8R0_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
3	A5PMI2	0.0	601	1216	0.203	0.257	A5PMI2_DANRE Zinc finger FYVE domain-containing protein 9 isoform X1 OS=Danio rerio OX=7955 GN=zfyve9a PE=4 SV=2
4	A8Y5G5	0.0	606	1338	0.200	0.230	A8Y5G5_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
5	E1C6T3	0.0	780	1416	0.288	0.313	E1C6T3_CHICK Zinc finger FYVE domain-containing protein OS=Gallus gallus OX=9031 GN=ZFYVE9 PE=4 SV=2
6	O95405	0.0	721	1425	0.247	0.267	ZFYV9_HUMAN Zinc finger FYVE domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZFYVE9 PE=1 SV=2
7	Q7Z3T8	0.0	3157	1539	1.000	1.000	ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3
8	Q7K9H6	1.65e-112	390	1343	0.147	0.169	Q7K9H6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=1 SV=1
9	Q960V6	6.44e-111	385	1343	0.147	0.168	Q960V6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=2 SV=1
10	Q80XL0	2.72e-85	281	267	0.094	0.539	Q80XL0_MOUSE Zfyve9 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfyve9 PE=2 SV=1
11	Q6PDX5	8.86e-76	253	242	0.084	0.533	Q6PDX5_MOUSE Zfyve9 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfyve9 PE=2 SV=1
12	Q9BQ24	2.49e-14	76.6	234	0.023	0.150	ZFY21_HUMAN Zinc finger FYVE domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZFYVE21 PE=1 SV=1
13	P34657	1.34e-13	75.1	266	0.021	0.120	YOTB_CAEEL Uncharacterized protein ZK632.12 OS=Caenorhabditis elegans OX=6239 GN=ZK632.12 PE=1 SV=2
14	Q99LI8	4.12e-13	77.0	775	0.021	0.041	HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus OX=10090 GN=Hgs PE=1 SV=2
15	Q9JJ50	4.16e-13	76.6	776	0.021	0.041	HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus OX=10116 GN=Hgs PE=1 SV=1
16	Q960X8	6.72e-13	76.3	760	0.022	0.045	HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster OX=7227 GN=Hrs PE=1 SV=1
17	A0A0S2Z4R4	6.94e-13	76.3	777	0.020	0.040	A0A0S2Z4R4_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=2 SV=1
18	O14964	6.94e-13	76.3	777	0.020	0.040	HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1
19	B7ZM68	7.64e-13	76.3	1178	0.021	0.028	B7ZM68_HUMAN FGD5 protein OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=1
20	Q96M96	8.08e-13	75.9	766	0.021	0.043	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11979 DUF3480	1.6e-155	529.0	Domain of unknown function (DUF3480)
2	PF01363 FYVE	1e-14	65.7	FYVE zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337159

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341551	0.991	Mothers against decapentaplegic homolog 4
2	9606.ENSP00000326031	0.978	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
3	9606.ENSP00000426568	0.955	Mothers against decapentaplegic homolog 1
4	9606.ENSP00000262160	0.950	Mothers against decapentaplegic homolog 2
5	9606.ENSP00000364133	0.918	TGF-beta receptor type-1
6	9606.ENSP00000308219	0.917	RGM domain family member B
7	9606.ENSP00000401907	0.916	Bone morphogenetic protein receptor type-1B
8	9606.ENSP00000363708	0.915	Bone morphogenetic protein receptor type-2
9	9606.ENSP00000200453	0.914	Protein phosphatase 1 regulatory subunit 15A
10	9606.ENSP00000245451	0.911	Bone morphogenetic protein 4
11	9606.ENSP00000361107	0.911	Bone morphogenetic protein receptor type-1A
12	9606.ENSP00000452126	0.911	Repulsive guidance molecule A
13	9606.ENSP00000368104	0.910	Bone morphogenetic protein 2
14	9606.ENSP00000351905	0.909	TGF-beta receptor type-2
15	9606.ENSP00000238682	0.906	Transforming growth factor beta-3
16	9606.ENSP00000337014	0.905	Hemojuvelin
17	9606.ENSP00000221930	0.900	Transforming growth factor beta-1
18	9606.ENSP00000265562	0.866	Tyrosine-protein phosphatase non-receptor type 23
19	9606.ENSP00000413697	0.865	Target of Myb protein 1
20	9606.ENSP00000332973	0.855	Mothers against decapentaplegic homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005545	1.000	1-phosphatidylinositol binding
GO:0005547	1.000	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0019899	0.580	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0051128	0.975	regulation of cellular component organization
GO:0061462	0.971	protein localization to lysosome
GO:0006623	0.970	protein targeting to vacuole
GO:0051049	0.958	regulation of transport
GO:0016197	0.958	endosomal transport
GO:0060627	0.942	regulation of vesicle-mediated transport
GO:0007041	0.919	lysosomal transport
GO:0030100	0.910	regulation of endocytosis
GO:0050896	0.411	response to stimulus
GO:0023052	0.340	signaling
GO:0007154	0.335	cell communication
GO:0048522	0.315	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098588	0.999	bounding membrane of organelle
GO:0005769	0.999	early endosome
GO:0005829	0.998	cytosol
GO:0012506	0.988	vesicle membrane
GO:0010008	0.975	endosome membrane
GO:0031901	0.962	early endosome membrane
GO:0032991	0.908	protein-containing complex
GO:0005634	0.856	nucleus
GO:0031974	0.584	membrane-enclosed lumen
GO:0043233	0.529	organelle lumen
GO:0070013	0.500	intracellular organelle lumen
GO:0005654	0.397	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]