StarFunc result for job id Q7Z3U7

User Input

>input (1717 residues)
MSGTSSPEAVKKLLENMQSDLRALSLECKKKFPPVKEAAESGIIKVKTIAARNTEILAAL
KENSSEVVQPFLMGCGTKEPKITQLCLAAIQRLMSHEVVSETAAGNIINMLWQLMENSLE
ELKLLQTVLVLLTTNTVVHDEALSKAIVLCFRLHFTKDNITNNTAAATVRQVVTVVFERM
VAEDERHRDIIEQPVLVQGNSNRRSVSTLKPCAKDAYMLFQDLCQLVNADAPYWLVGMTE
MTRTFGLELLESVLNDFPQVFLQHQEFSFLLKERVCPLVIKLFSPNIKFRQGSSTSSSPA
PVEKPYFPICMRLLRVVSVLIKQFYSLLVTECEIFLSLLVKFLDADKPQWLRAVAVESIH
RFCVQPQLLRSFCQSYDMKQHSTKVFRDIVNALGSFIQSLFLVPPTGNPATSNQAGNNNL
GGSVSAPANSGMVGIGGGVTLLPAFEYRGTWIPILTITVQGSAKATYLEMLDKVEPPTIP
EGYAMSVAFHCLLDLVRGITSMIEGELGELETECQTTTEEGSSPTQSTEQQDLQSTSDQM
DKEIVSRAVWEEMVNACWCGLLAALSLLLDASTDEAATENILKAELTMAALCGRLGLVTS
RDAFITAICKGSLPPHYALTVLNTTTAATLSNKSYSVQGQSVMMISPSSESHQQVVAVGQ
PLAVQPQGTVMLTSKNIQCMRTLLNLAHCHGAVLGTSWQLVLATLQHLVWILGLKPSSGG
ALKPGRAVEGPSTVLTTAVMTDLPVISNILSRLFESSQYLDDVSLHHLINALCSLSLEAM
DMAYGNNKEPSLFAVAKLLETGLVNMHRIEILWRPLTGHLLEVCQHPNSRMREWGAEALT
SLIKAGLTFNHDPPLSQNQRLQLLLLNPLKEMSNINHPDIRLKQLECVLQILQSQGDSLG
PGWPLVLGVMGAIRNDQGESLIRTAFQCLQLVVTDFLPTMPCTCLQIVVDVAGSFGLHNQ
ELNISLTSIGLLWNISDYFFQRGETIEKELNKEEAAQQKQAEEKGVVLNRPFHPAPPFDC
LWLCLYAKLGELCVDPRPAVRKSAGQTLFSTIGAHGTLLQHSTWHTVIWKVLFHLLDRVR
ESSTTADKEKIESGGGNILIHHSRDTAEKQWAETWVLTLAGVARIFNTRRYLLQPLGDFS
RAWDVLLDHIQSAALSKNNEVSLAALKSFQEILQIVSPVRDSDKPETPPVVNVPVPVLIG
PISGMSRPFVRTDSIGEKLGRYSSSEPPIVTDELEDLNLWWAAWNTWYRIGSESTKPPIT
FDKLTFIPSQPFLTALIQIFPALYQHIKTGFNMDDLQKLGVILHSAISVPISSDASPFIL
PSYTEAVLTSLQEAVLTALDVLQKAICVGPENMQIMYPAIFDQLLAFVEFSCKPPQYGQL
ETKHIANAKYNQIQLFAPAEWVALNYVPFAERSLEVVVDLYQKTACHKAVVNEKVLQNII
KTLRVPLSLKYSCPSESTWKLAVSSLLRVLSIGLPVARQHASSGKFDSMWPELANTFEDF
LFTKSIPPDNLSIQEFQRNENIDVEVVQLISNEILPYANFIPKEFVGQIMTMLNKGSIHS
QSSSFTEAEIDIRLREEFSKMCFETLLQFSFSNKVTTPQEGYISRMALSVLLKRSQDVLH
RYIEDERLSGKCPLPRQQVTEIIFVLKAVSTLIDSLKKTQPENVDGNTWAQVIALYPTLV
ECITCSSSEVCSALKEALVPFKDFMQPPASRVQNGES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3U7	1.000	1.000	0.000	1717	1.000	1.000	Q7Z3U7.pdb.gz	MON2_HUMAN Protein MON2 homolog OS=Homo sapiens OX=9606 GN=MON2 PE=1 SV=3
2	AFDB:Q9VLT1	0.795	0.809	0.000	1684	0.471	0.480	Q9VLT1.pdb.gz	MON2_DROME Protein MON2 homolog OS=Drosophila melanogaster OX=7227 GN=mon2 PE=2 SV=4
3	AFDB:Q09853	0.449	0.472	1.740E-41	1616	0.182	0.193	Q09853.pdb.gz	MON2_SCHPO Protein MON2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mon2 PE=1 SV=1
4	AFDB:P48563	0.386	0.403	1.505E-40	1636	0.178	0.186	P48563.pdb.gz	MON2_YEAST Protein MON2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MON2 PE=1 SV=1
5	AFDB:Q9LPC5	0.407	0.401	5.597E-27	1750	0.165	0.162	Q9LPC5.pdb.gz	BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana OX=3702 GN=BIG3 PE=1 SV=1
6	AFDB:Q9LZX8	0.425	0.409	1.959E-26	1793	0.174	0.166	Q9LZX8.pdb.gz	BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana OX=3702 GN=BIG2 PE=2 SV=1
7	AFDB:E7FCG1	0.432	0.405	2.499E-26	1846	0.155	0.144	E7FCG1.pdb.gz	E7FCG1_DANRE ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) OS=Danio rerio OX=7955 GN=arfgef2 PE=1 SV=1
8	AFDB:Q9Y6D6	0.430	0.403	5.964E-26	1849	0.169	0.157	Q9Y6D6.pdb.gz	BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2
9	AFDB:Q7TSU1	0.434	0.417	1.196E-25	1791	0.154	0.147	Q7TSU1.pdb.gz	BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus OX=10116 GN=Arfgef2 PE=1 SV=1
10	AFDB:F4JSZ5	0.418	0.425	4.982E-25	1687	0.150	0.153	F4JSZ5.pdb.gz	BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana OX=3702 GN=BIG1 PE=2 SV=1
11	PDB:7mq8LM	0.129	0.116	5.273E-10	2005	0.131	0.112	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mqaLM	0.143	0.128	5.853E-10	2041	0.131	0.110	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mqaSP	0.137	0.112	8.886E-10	2485	0.125	0.086	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mq8SP	0.105	0.098	9.864E-10	1993	0.140	0.120	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7tyrA	0.112	0.073	3.110E-9	3905	0.139	0.061	7tyrA.pdb.gz
16	PDB:7otmA	0.108	0.070	4.404E-9	3656	0.128	0.060	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
17	PDB:4a0cA	0.128	0.180	5.427E-9	1155	0.095	0.141	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
18	PDB:7sukSP	0.109	0.092	6.237E-9	2234	0.128	0.098	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
19	PDB:7ajuUT	0.121	0.098	7.422E-9	2313	0.116	0.086	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:6kwyc	0.137	0.131	7.957E-9	1811	0.130	0.123	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3U7	0.0	3536	1717	1.000	1.000	MON2_HUMAN Protein MON2 homolog OS=Homo sapiens OX=9606 GN=MON2 PE=1 SV=3
2	Q9VLT1	0.0	1504	1684	0.479	0.489	MON2_DROME Protein MON2 homolog OS=Drosophila melanogaster OX=7227 GN=mon2 PE=2 SV=4
3	Q09853	1.13e-46	187	1616	0.147	0.157	MON2_SCHPO Protein MON2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mon2 PE=1 SV=1
4	P48563	1.35e-38	160	1636	0.151	0.159	MON2_YEAST Protein MON2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MON2 PE=1 SV=1
5	Q9LPC5	2.34e-22	107	1750	0.084	0.083	BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana OX=3702 GN=BIG3 PE=1 SV=1
6	Q9LZX8	2.03e-21	104	1793	0.075	0.072	BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana OX=3702 GN=BIG2 PE=2 SV=1
7	F4IXW2	2.29e-21	104	1739	0.061	0.060	BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana OX=3702 GN=BIG5 PE=1 SV=2
8	E7FCG1	1.06e-19	99.4	1846	0.058	0.054	E7FCG1_DANRE ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) OS=Danio rerio OX=7955 GN=arfgef2 PE=1 SV=1
9	D4A631	1.36e-18	95.5	1846	0.062	0.057	BIG1_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Rattus norvegicus OX=10116 GN=Arfgef1 PE=1 SV=1
10	Q9Y6D6	1.88e-18	95.1	1849	0.061	0.057	BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2
11	Q9Y6D5	1.75e-16	88.6	1785	0.056	0.054	BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3
12	Q9VJW1	3.11e-16	87.8	1653	0.040	0.042	Q9VJW1_DROME LD29171p OS=Drosophila melanogaster OX=7227 GN=Sec71 PE=1 SV=2
13	Q7TSU1	8.61e-16	86.3	1791	0.057	0.055	BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus OX=10116 GN=Arfgef2 PE=1 SV=1
14	F4JSZ5	1.79e-15	85.1	1687	0.066	0.068	BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana OX=3702 GN=BIG1 PE=2 SV=1
15	F4JN05	1.65e-14	82.0	1706	0.047	0.047	BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana OX=3702 GN=BIG4 PE=3 SV=1
16	Q9UT02	1.23e-09	66.2	1811	0.056	0.053	SEC7A_SCHPO Protein transport protein sec71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec71 PE=1 SV=1
17	Q9FLY5	4.38e-07	57.8	1443	0.058	0.069	GNL1_ARATH ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana OX=3702 GN=GNL1 PE=3 SV=1
18	Q9P7V5	3.35e-06	54.7	1822	0.043	0.041	SEC7B_SCHPO Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec72 PE=1 SV=1
19	P11075	8.92e-04	47.0	2009	0.038	0.033	SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC7 PE=1 SV=2
20	Q42510	0.006	43.9	1451	0.015	0.017	GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16213 DCB	8.8e-58	206.4	Dimerisation and cyclophilin-binding domain of Mon2
2	PF09324 DUF1981	2.4e-15	67.5	Domain of unknown function (DUF1981)
3	PF02985 HEAT	0.19	23.1	HEAT repeat
4	PF09775 Keratin_assoc	64	14.6	Keratinocyte-associated protein 2
5	PF16206 Mon2_C	0	1374.8	C-terminal region of Mon2 protein
6	PF12783 Sec7_N	2.1e-51	185.4	Guanine nucleotide exchange factor in Golgi transport N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377250

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000237163	0.972	Protein dopey-1
2	9606.ENSP00000382104	0.932	Protein dopey-2
3	9606.ENSP00000261636	0.848	ADP-ribosylation factor-like protein 1
4	9606.ENSP00000299138	0.820	Vacuolar protein sorting-associated protein 35
5	9606.ENSP00000243918	0.813	Protein SYS1 homolog
6	9606.ENSP00000255882	0.808	Phosphatidylinositol 4-kinase alpha
7	9606.ENSP00000308496	0.800	ADP-ribosylation factor-like protein 10
8	9606.ENSP00000380635	0.800	ADP-ribosylation factor-like protein 16
9	9606.ENSP00000359000	0.775	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
10	9606.ENSP00000479606	0.751	Clathrin heavy chain 1
11	9606.ENSP00000342481	0.750	Probable phospholipid-transporting ATPase IIA
12	9606.ENSP00000441158	0.750	Clathrin heavy chain 2
13	9606.ENSP00000320949	0.746	CCR4-NOT transcription complex subunit 1
14	9606.ENSP00000384869	0.738	Clathrin heavy chain linker domain containing 1
15	9606.ENSP00000437554	0.737	IQ motif and SEC7 domain-containing protein 3
16	9606.ENSP00000347416	0.729	AP-3 complex subunit delta-1
17	9606.ENSP00000310551	0.709	Lysocardiolipin acyltransferase 1
18	9606.ENSP00000357928	0.701	Pre-mRNA-processing factor 17
19	9606.ENSP00000336724	0.699	TBC1 domain family member 22A
20	9606.ENSP00000283351	0.692	Trafficking protein particle complex subunit 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0051179	0.980	localization
GO:0051641	0.950	cellular localization
GO:0071840	0.929	cellular component organization or biogenesis
GO:0016043	0.924	cellular component organization
GO:0033036	0.784	macromolecule localization
GO:0006996	0.713	organelle organization
GO:0070727	0.595	cellular macromolecule localization
GO:0008104	0.581	protein localization
GO:0051234	0.508	establishment of localization
GO:0032502	0.476	developmental process
GO:0006810	0.449	transport
GO:0048856	0.413	anatomical structure development
GO:0065007	0.407	biological regulation
GO:0032501	0.395	multicellular organismal process
GO:0050789	0.338	regulation of biological process
GO:0050794	0.333	regulation of cellular process
GO:0007275	0.306	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	0.999	endosome
GO:0031090	0.997	organelle membrane
GO:0098588	0.994	bounding membrane of organelle
GO:0005576	0.988	extracellular region
GO:0030659	0.979	cytoplasmic vesicle membrane
GO:0005829	0.935	cytosol
GO:0005615	0.930	extracellular space
GO:0043230	0.921	extracellular organelle
GO:1903561	0.912	extracellular vesicle
GO:0010008	0.912	endosome membrane
GO:0005769	0.893	early endosome
GO:0070062	0.890	extracellular exosome
GO:0031901	0.828	early endosome membrane
GO:0005794	0.731	Golgi apparatus
GO:0005886	0.307	plasma membrane
GO:0043233	0.301	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]