StarFunc result for job id Q7Z3V4

User Input

>input (1068 residues)
MFTLSQTSRAWFIDRARQAREERLVQKERERAAVVIQAHVRSFLCRSRLQRDIRREIDDF
FKADDPESTKRSALCIFKIARKLLFLFRIKEDNERFEKLCRSILSSMDAENEPKVWYVSL
ACSKDLTLLWIQQIKNILWYCCDFLKQLKPEILQDSRLITLYLTMLVTFTDTSTWKILRG
KGESLRPAMNHICANIMGHLNQHGFYSVLQILLTRGLARPRPCLSKGTLTAAFSLALRPV
IAAQFSDNLIRPFLIHIMSVPALVTHLSTVTPERLTVLESHDMLRKFIIFLRDQDRCRDV
CESLEGCHTLCLMGNLLHLGSLSPRVLEEETDGFVSLLTQTLCYCRKYVSQKKSNLTHWH
PVLGWFSQSVDYGLNESMHLITKQLQFLWGVPLIRIFFCDILSKKLLESQEPAHAQPASP
QNVLPVKSLLKRAFQKSASVRNILRPVGGKRVDSAEVQKVCNICVLYQTSLTTLTQIRLQ
ILTGLTYLDDLLPKLWAFICELGPHGGLKLFLECLNNDTEESKQLLAMLMLFCDCSRHLI
TILDDIEVYEEQISFKLEELVTISSFLNSFVFKMIWDGIVENAKGETLELFQSVHGWLMV
LYERDCRRRFTPEDHWLRKDLKPSVLFQELDRDRKRAQLILQYIPHVIPHKNRVLLFRTM
VTKEKEKLGLVETSSASPHVTHITIRRSRMLEDGYEQLRQLSQHAMKGVIRVKFVNDLGV
DEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHENYLQLFEFVGK
MLGKAVYEGIVVDVPFASFFLSQLLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDI
TDLGLTLSYDEDVMGQLVCHELIPGGKTIPVTNENKISYIHLMAHFRMHTQIKNQTAALI
SGFRSIIKPEWIRMFSTPELQRLISGDNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWDIL
ASDFTPDERAMFLKFVTSCSRPPLLGFAYLKPPFSIRCVEVSDDQDTGDTLGSVLRGFFT
IRKREPGGRLPTSSTCFNLLKLPNYSKKSVLREKLRYAISMNTGFELS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15386	0.625	0.617	2.343E-42	1083	0.268	0.264	Q15386.pdb.gz	UBE3C_HUMAN Ubiquitin-protein ligase E3C OS=Homo sapiens OX=9606 GN=UBE3C PE=1 SV=3
2	AFDB:Q9W196	0.598	0.572	4.134E-40	1122	0.277	0.264	Q9W196.pdb.gz	Q9W196_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3356 PE=1 SV=1
3	AFDB:Q1K9C4	0.558	0.577	1.527E-37	1029	0.244	0.254	Q1K9C4.pdb.gz	YFK7_SCHPO Probable E3 ubiquitin protein ligase C167.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC167.07c PE=2 SV=1
4	AFDB:O17736	0.526	0.557	1.153E-32	1001	0.202	0.216	O17736.pdb.gz	ETC1_CAEEL E3 ubiquitin-protein ligase etc-1 OS=Caenorhabditis elegans OX=6239 GN=etc-1 PE=1 SV=1
5	AFDB:P53119	0.569	0.654	3.169E-30	910	0.231	0.271	P53119.pdb.gz	HUL5_YEAST E3 ubiquitin-protein ligase HUL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL5 PE=1 SV=1
6	AFDB:Q8IYU2	0.258	0.299	5.886E-23	909	0.184	0.216	Q8IYU2.pdb.gz	HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens OX=9606 GN=HACE1 PE=1 SV=2
7	AFDB:F8W2M1	0.246	0.287	7.347E-23	904	0.184	0.218	F8W2M1.pdb.gz	HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio OX=7955 GN=hace1 PE=3 SV=2
8	AFDB:Q05086	0.350	0.418	7.818E-22	875	0.145	0.177	Q05086.pdb.gz	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
9	AFDB:Q5U5R9	0.361	0.473	8.112E-22	776	0.137	0.188	Q5U5R9.pdb.gz	HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens OX=9606 GN=HECTD2 PE=1 SV=2
10	AFDB:E8NHA2	0.363	0.364	8.417E-22	1062	0.116	0.117	E8NHA2.pdb.gz	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
11	PDB:7jq9A	0.239	0.111	1.068E-21	2427	0.184	0.081	7jq9A.pdb.gz
12	PDB:7mopA	0.207	0.096	2.154E-21	2445	0.198	0.086	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
13	PDB:6vaeA	0.105	0.097	4.278E-4	1198	0.110	0.098	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
14	PDB:7unkA	0.137	0.139	1.038E-3	1047	0.104	0.106	7unkA.pdb.gz
15	PDB:7ay1A	0.132	0.136	1.875E-3	1033	0.112	0.116	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
16	PDB:5uwuC	0.130	0.135	2.713E-3	998	0.105	0.112	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
17	PDB:3w3uA	0.120	0.123	4.227E-3	1030	0.112	0.117	3w3uA.pdb.gz
18	PDB:3gb8A	0.122	0.131	4.901E-3	958	0.099	0.111	3gb8A.pdb.gz
19	PDB:3gjxA	0.144	0.147	5.085E-3	1041	0.101	0.104	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
20	PDB:6uqkA	0.178	0.105	5.085E-3	2054	0.133	0.069	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9W196	5.01e-100	343	1122	0.223	0.212	Q9W196_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3356 PE=1 SV=1
2	Q15386	9.21e-98	336	1083	0.213	0.211	UBE3C_HUMAN Ubiquitin-protein ligase E3C OS=Homo sapiens OX=9606 GN=UBE3C PE=1 SV=3
3	Q1K9C4	1.93e-86	303	1029	0.187	0.194	YFK7_SCHPO Probable E3 ubiquitin protein ligase C167.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC167.07c PE=2 SV=1
4	P53119	1.05e-64	238	910	0.184	0.215	HUL5_YEAST E3 ubiquitin-protein ligase HUL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL5 PE=1 SV=1
5	O17736	1.43e-57	218	1001	0.129	0.138	ETC1_CAEEL E3 ubiquitin-protein ligase etc-1 OS=Caenorhabditis elegans OX=6239 GN=etc-1 PE=1 SV=1
6	Q8GY23	1.81e-50	198	3681	0.127	0.037	UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana OX=3702 GN=UPL1 PE=1 SV=3
7	Q8H0T4	3.07e-50	197	3658	0.128	0.037	UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana OX=3702 GN=UPL2 PE=1 SV=3
8	F8W2M1	8.37e-50	193	904	0.118	0.139	HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio OX=7955 GN=hace1 PE=3 SV=2
9	O13834	2.28e-48	191	3227	0.126	0.042	PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr1 PE=1 SV=1
10	Q7TMY8	2.59e-48	191	4377	0.125	0.031	HUWE1_MOUSE E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus OX=10090 GN=Huwe1 PE=1 SV=5
11	P51593	2.67e-48	191	4454	0.125	0.030	HUWE1_RAT E3 ubiquitin-protein ligase HUWE1 OS=Rattus norvegicus OX=10116 GN=Huwe1 PE=1 SV=3
12	Q7Z6Z7	3.27e-48	191	4374	0.125	0.031	HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3
13	Q9VVI3	1.75e-47	187	1007	0.128	0.136	NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster OX=7227 GN=Nedd4 PE=1 SV=2
14	O14326	2.41e-47	184	786	0.117	0.159	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
15	Q3KRP0	8.49e-47	184	910	0.126	0.148	Q3KRP0_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=si:ch211-79l17.5 PE=2 SV=1
16	Q96J02	2.33e-46	182	903	0.112	0.133	ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=2
17	A0A590UJW8	2.34e-46	182	830	0.112	0.145	A0A590UJW8_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
18	U6C7R6	2.37e-46	182	867	0.113	0.140	U6C7R6_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=itcha PE=1 SV=1
19	P46935	2.64e-46	182	887	0.125	0.150	NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus OX=10090 GN=Nedd4 PE=1 SV=3
20	Q8IYU2	2.79e-46	182	909	0.113	0.133	HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens OX=9606 GN=HACE1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00632 HECT	2e-88	308.4	HECT-domain (ubiquitin-transferase)
2	PF00612 IQ	1.1	20.2	IQ calmodulin-binding motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315664	0.836	Zinc finger protein 18
2	9606.ENSP00000392043	0.779	Plasma membrane calcium-transporting ATPase 1
3	9606.ENSP00000406191	0.770	Transient receptor potential cation channel subfamily V member 4
4	9606.ENSP00000480364	0.703	RCC1-like G exchanging factor-like protein
5	9606.ENSP00000337998	0.685	Nck-associated protein 5-like
6	9606.ENSP00000440045	0.660	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
7	9606.ENSP00000316909	0.647	Vesicular glutamate transporter 3
8	9606.ENSP00000002125	0.637	Protein arginine methyltransferase NDUFAF7, mitochondrial
9	9606.ENSP00000414904	0.608	Cathepsin O
10	9606.ENSP00000217958	0.596	26S proteasome non-ATPase regulatory subunit 10
11	9606.ENSP00000360613	0.571	Ubiquitin-conjugating enzyme E2 A
12	9606.ENSP00000412566	0.568	Small nuclear ribonucleoprotein-associated proteins B and B
13	9606.ENSP00000414147	0.552	Spartin
14	9606.ENSP00000223321	0.514	Proteasome subunit alpha type-2
15	9606.ENSP00000363616	0.514	ER degradation-enhancing alpha-mannosidase-like protein 2
16	9606.ENSP00000264552	0.509	Ubiquitin-conjugating enzyme E2 S
17	9606.ENSP00000307831	0.509	Adhesion G-protein coupled receptor F3
18	9606.ENSP00000261712	0.508	26S proteasome non-ATPase regulatory subunit 11
19	9606.ENSP00000291295	0.501	Calmodulin 3 (phosphorylase kinase, delta)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0019538	0.988	protein metabolic process
GO:0009987	0.963	cellular process
GO:0070647	0.901	protein modification by small protein conjugation or removal
GO:0016567	0.890	protein ubiquitination
GO:0065007	0.817	biological regulation
GO:0050789	0.693	regulation of biological process
GO:0044237	0.578	cellular metabolic process
GO:0006508	0.398	proteolysis
GO:0050794	0.379	regulation of cellular process
GO:0044260	0.348	cellular macromolecule metabolic process
GO:0000209	0.308	protein polyubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.997	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0005829	0.993	cytosol
GO:0016020	0.984	membrane
GO:0031981	0.980	nuclear lumen
GO:0012505	0.975	endomembrane system
GO:0005654	0.870	nucleoplasm
GO:0031090	0.327	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]