StarFunc result for job id Q7Z3Y7

User Input

>input (464 residues)
MSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGS
HAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKG
WYEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYE
NELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAG
GNVNVEMNAAPGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAAT
FARSQLTEMRRTLQTLEIQLQSLMATKHSLECSLTETESNYCTQLAQIQAQIGALEEQLH
QVRTETEGQKLEYEHLLDVKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSPGNSSKDLS
KTTLVKTVVEELDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3Y7	1.000	1.000	1.318E-62	464	1.000	1.000	Q7Z3Y7.pdb.gz	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
2	AFDB:Q7Z3Y8	0.599	0.605	4.615E-47	459	0.763	0.771	Q7Z3Y8.pdb.gz	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
3	AFDB:Q9Z320	0.480	0.495	2.182E-43	448	0.737	0.763	Q9Z320.pdb.gz	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
4	AFDB:Q7Z3Z0	0.559	0.574	1.147E-41	450	0.720	0.742	Q7Z3Z0.pdb.gz	K1C25_HUMAN Keratin, type I cytoskeletal 25 OS=Homo sapiens OX=9606 GN=KRT25 PE=1 SV=1
5	AFDB:Q7Z3Y9	0.452	0.449	3.522E-40	468	0.685	0.679	Q7Z3Y9.pdb.gz	K1C26_HUMAN Keratin, type I cytoskeletal 26 OS=Homo sapiens OX=9606 GN=KRT26 PE=1 SV=2
6	AFDB:Q6IFX1	0.482	0.459	7.079E-31	491	0.547	0.517	Q6IFX1.pdb.gz	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
7	AFDB:Q2M2I5	0.500	0.451	2.536E-30	525	0.562	0.497	Q2M2I5.pdb.gz	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
8	AFDB:Q99456	0.513	0.488	3.979E-29	494	0.522	0.490	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
9	AFDB:Q64291	0.387	0.372	1.994E-28	487	0.517	0.493	Q64291.pdb.gz	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
10	AFDB:Q6IFV1	0.369	0.356	9.343E-28	485	0.504	0.482	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
11	PDB:4ariA	0.039	0.023	1.099	821	0.015	0.009	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
12	PDB:5tthA	0.043	0.031	2.301	671	0.015	0.010	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
13	PDB:3okrC	0.041	0.084	3.010	194	0.013	0.031	3okrC.pdb.gz	Crystal Structure of the Mycobacterium tuberculosis 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD): an antitubercular drug target
14	PDB:3zgzD	0.037	0.020	3.219	867	0.015	0.008	3zgzD.pdb.gz	Plant Tumour Biocontrol Agent Employs a tRNA-Dependent Mechanism to Inhibit Leucyl-tRNA Synthetase
15	PDB:3m3rC	0.050	0.068	3.938	293	0.017	0.027	3m3rC.pdb.gz
16	PDB:2e31A	0.051	0.092	4.211	246	0.011	0.020	2e31A.pdb.gz
17	PDB:2xwnB	0.049	0.088	4.211	227	0.009	0.018	2xwnB.pdb.gz	Structural and Functional Studies on Mycobacterial Ispd Enzymes
18	PDB:1gvpA	0.032	0.127	4.504	87	0.011	0.057	1gvpA.pdb.gz
19	PDB:3ul5D	0.034	0.143	4.504	84	0.013	0.071	3ul5D.pdb.gz
20	PDB:6jztA	0.053	0.060	4.504	402	0.004	0.005	6jztA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3Y7	0.0	952	464	1.000	1.000	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
2	Q7Z3Y8	0.0	684	459	0.763	0.771	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
3	Q7Z3Y9	0.0	628	468	0.685	0.679	K1C26_HUMAN Keratin, type I cytoskeletal 26 OS=Homo sapiens OX=9606 GN=KRT26 PE=1 SV=2
4	Q7Z3Z0	0.0	655	450	0.709	0.731	K1C25_HUMAN Keratin, type I cytoskeletal 25 OS=Homo sapiens OX=9606 GN=KRT25 PE=1 SV=1
5	Q8VCW2	0.0	664	446	0.711	0.740	K1C25_MOUSE Keratin, type I cytoskeletal 25 OS=Mus musculus OX=10090 GN=Krt25 PE=1 SV=1
6	Q9Z320	0.0	653	448	0.733	0.759	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
7	Q64291	2.82e-147	431	487	0.483	0.460	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
8	P13645	7.78e-146	431	584	0.463	0.368	K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6
9	Q99456	9.36e-146	427	494	0.470	0.441	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
10	Q6IFX1	6.00e-145	425	491	0.485	0.458	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
11	Q2M2I5	1.77e-142	420	525	0.485	0.429	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
12	Q6IFU8	6.74e-141	412	433	0.481	0.515	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
13	Q9QWL7	6.74e-141	412	433	0.481	0.515	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
14	P02535	5.30e-140	415	570	0.448	0.365	K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3
15	Q04695	5.18e-138	405	432	0.450	0.484	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
16	P02533	3.44e-133	394	472	0.425	0.417	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
17	P08779	6.45e-133	394	473	0.429	0.421	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
18	Q6IFV1	6.61e-131	389	485	0.416	0.398	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
19	Q6IFV4	2.74e-130	385	438	0.422	0.447	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
20	P13646	3.92e-130	386	458	0.418	0.424	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02520 ANIS5_cation-bd	9.5e+02	11.3	SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
2	PF00038 Filament	2.5e-93	324.7	Intermediate filament protein
3	PF14282 FlxA	52	15.3	FlxA-like protein
4	PF07352 Phage_Mu_Gam	18	16.6	Bacteriophage Mu Gam like protein
5	PF12918 TcdB_N	6.7e+02	12.0	TcdB toxin N-terminal helical domain
6	PF07926 TPR_MLP1_2	26	16.3	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305263

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000007735	0.588	Keratin, type I cuticular Ha3-I
2	9606.ENSP00000377558	0.578	Keratin, type I cuticular Ha5
3	9606.ENSP00000251645	0.576	Keratin, type I cuticular Ha1
4	9606.ENSP00000246646	0.566	Keratin, type I cuticular Ha8
5	9606.ENSP00000251646	0.561	Keratin, type I cuticular Ha3-II
6	9606.ENSP00000347823	0.543	Keratin, type I cytoskeletal 39
7	9606.ENSP00000366984	0.538	Keratin, type I cytoskeletal 40
8	9606.ENSP00000225899	0.532	Keratin, type I cuticular Ha2
9	9606.ENSP00000209718	0.531	Keratin, type I cytoskeletal 23
10	9606.ENSP00000225550	0.527	Keratin, type I cuticular Ha7
11	9606.ENSP00000246662	0.520	Keratin, type I cytoskeletal 9
12	9606.ENSP00000308452	0.518	Keratin, type I cytoskeletal 17
13	9606.ENSP00000377570	0.511	Keratin, type I cuticular Ha4
14	9606.ENSP00000454562	0.510	Deoxyribonuclease-1-like 2
15	9606.ENSP00000264651	0.509	Keratin, type I cytoskeletal 24
16	9606.ENSP00000251643	0.507	Keratin, type I cytoskeletal 12
17	9606.ENSP00000373487	0.507	Keratin, type I cytoskeletal 18
18	9606.ENSP00000355890	0.506	Bifunctional glutamate/proline--tRNA ligase
19	9606.ENSP00000329165	0.504	Keratin, type I cuticular Ha6
20	9606.ENSP00000366612	0.503	COBW domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.469	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0009987	0.986	cellular process
GO:0032501	0.928	multicellular organismal process
GO:0008544	0.868	epidermis development
GO:0071840	0.860	cellular component organization or biogenesis
GO:0043588	0.859	skin development
GO:0042303	0.835	molting cycle
GO:0016043	0.829	cellular component organization
GO:0042633	0.797	hair cycle
GO:0022404	0.765	molting cycle process
GO:0009653	0.699	anatomical structure morphogenesis
GO:0006996	0.697	organelle organization
GO:0007010	0.692	cytoskeleton organization
GO:0060429	0.622	epithelium development
GO:0045103	0.529	intermediate filament-based process
GO:0002009	0.457	morphogenesis of an epithelium
GO:0045104	0.302	intermediate filament cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0070062	1.000	extracellular exosome
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0005856	0.933	cytoskeleton
GO:0045111	0.887	intermediate filament cytoskeleton
GO:0099513	0.861	polymeric cytoskeletal fiber
GO:0005882	0.852	intermediate filament
GO:0043231	0.575	intracellular membrane-bounded organelle
GO:0005634	0.317	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]