StarFunc result for job id Q7Z3Y8

User Input

>input (459 residues)
MSVRFSSTSRRLGSCGGTGSVRLSSGGAGFGAGNTCGVPGIGSGFSCAFGGSSSAGGYGG
GLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWY
EKFGPGSCRGLDHDYSRYFPIIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENE
LALHQSVEADINGLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSA
RNELIEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQV
RTETEGQKLEYEQLLDIKVHLEKEIETYCLLIDGEDGSCSKSKGYGGPGNQTKDSSKTTI
VKTVVEEIDPRGKVLSSRVHTVEEKSTKVNNKNEQRVSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3Y8	1.000	1.000	1.124E-62	459	1.000	1.000	Q7Z3Y8.pdb.gz	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
2	AFDB:Q9Z320	0.598	0.611	4.550E-52	448	0.871	0.893	Q9Z320.pdb.gz	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
3	AFDB:Q7Z3Y7	0.606	0.600	9.471E-47	464	0.769	0.761	Q7Z3Y7.pdb.gz	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
4	AFDB:Q7Z3Z0	0.586	0.596	3.180E-46	450	0.797	0.813	Q7Z3Z0.pdb.gz	K1C25_HUMAN Keratin, type I cytoskeletal 25 OS=Homo sapiens OX=9606 GN=KRT25 PE=1 SV=1
5	AFDB:Q7Z3Y9	0.534	0.526	8.098E-41	468	0.730	0.716	Q7Z3Y9.pdb.gz	K1C26_HUMAN Keratin, type I cytoskeletal 26 OS=Homo sapiens OX=9606 GN=KRT26 PE=1 SV=2
6	AFDB:Q6IFX1	0.560	0.529	1.045E-30	491	0.566	0.530	Q6IFX1.pdb.gz	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
7	AFDB:Q99456	0.507	0.478	1.367E-30	494	0.542	0.504	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
8	AFDB:Q2M2I5	0.408	0.362	3.066E-30	525	0.593	0.518	Q2M2I5.pdb.gz	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
9	AFDB:Q64291	0.532	0.505	8.412E-30	487	0.529	0.499	Q64291.pdb.gz	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
10	AFDB:Q6IFU8	0.566	0.593	7.748E-29	433	0.510	0.540	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
11	PDB:7wtwV	0.051	0.225	2.134	83	0.013	0.072	7wtwV.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
12	PDB:1jkfA	0.053	0.052	2.283	466	0.004	0.004	1jkfA.pdb.gz	The crystal structure and mechanism of 1-L-myo-inositol- 1-phosphate synthase
13	PDB:7tysA	0.038	0.046	2.283	361	0.017	0.022	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
14	PDB:1dw9A	0.048	0.124	2.612	156	0.009	0.026	1dw9A.pdb.gz
15	PDB:1p1fA	0.052	0.048	2.794	501	0.004	0.004	1p1fA.pdb.gz
16	PDB:5datC1	0.055	0.146	2.794	155	0.009	0.026	5datC1.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
17	PDB:3j7aZ	0.049	0.262	2.988	72	0.009	0.056	3j7aZ.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
18	PDB:7mjpA	0.038	0.045	2.988	366	0.011	0.014	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
19	PDB:1jkiA	0.053	0.046	3.196	525	0.004	0.004	1jkiA.pdb.gz	The crystal structure and mechanism of 1-L-myo-inositol- 1-phosphate synthase
20	PDB:3b07B	0.048	0.076	3.196	270	0.002	0.004	3b07B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3Y7	0.0	706	464	0.773	0.765	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
2	Q7Z3Y8	0.0	939	459	1.000	1.000	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
3	Q7Z3Y9	0.0	659	468	0.743	0.729	K1C26_HUMAN Keratin, type I cytoskeletal 26 OS=Homo sapiens OX=9606 GN=KRT26 PE=1 SV=2
4	Q7Z3Z0	0.0	706	450	0.795	0.811	K1C25_HUMAN Keratin, type I cytoskeletal 25 OS=Homo sapiens OX=9606 GN=KRT25 PE=1 SV=1
5	Q8VCW2	0.0	714	446	0.786	0.809	K1C25_MOUSE Keratin, type I cytoskeletal 25 OS=Mus musculus OX=10090 GN=Krt25 PE=1 SV=1
6	Q9Z320	0.0	765	448	0.869	0.891	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
7	Q64291	1.91e-148	434	487	0.492	0.464	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
8	Q6IFX1	2.63e-147	431	491	0.492	0.460	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
9	Q2M2I5	3.93e-147	432	525	0.503	0.440	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
10	P13645	2.25e-146	432	584	0.471	0.370	K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6
11	Q99456	4.31e-146	428	494	0.540	0.502	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
12	Q6IFU8	5.42e-143	417	433	0.501	0.531	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
13	Q9QWL7	5.39e-142	415	433	0.499	0.529	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
14	P02535	1.91e-138	411	570	0.449	0.361	K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3
15	Q04695	5.90e-138	405	432	0.458	0.486	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
16	Q6IFV4	3.55e-134	395	438	0.438	0.459	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
17	P08779	9.14e-134	395	473	0.431	0.419	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
18	P02533	4.00e-132	391	472	0.447	0.434	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
19	P08730	3.06e-131	388	437	0.434	0.455	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
20	P13646	1.02e-130	387	458	0.427	0.428	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	4.2e-95	330.6	Intermediate filament protein
2	PF07926 TPR_MLP1_2	5.7	18.4	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301656

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377558	0.721	Keratin, type I cuticular Ha5
2	9606.ENSP00000251645	0.656	Keratin, type I cuticular Ha1
3	9606.ENSP00000329165	0.653	Keratin, type I cuticular Ha6
4	9606.ENSP00000007735	0.648	Keratin, type I cuticular Ha3-I
5	9606.ENSP00000251646	0.630	Keratin, type I cuticular Ha3-II
6	9606.ENSP00000366950	0.573	Keratin-associated protein 9-2
7	9606.ENSP00000375151	0.568	Keratin-associated protein 4-3
8	9606.ENSP00000479656	0.554	Keratin-associated protein 7-1
9	9606.ENSP00000313699	0.543	Hephaestin-like protein 1
10	9606.ENSP00000246646	0.542	Keratin, type I cuticular Ha8
11	9606.ENSP00000167588	0.538	Keratin, type I cytoskeletal 20
12	9606.ENSP00000308452	0.537	Keratin, type I cytoskeletal 17
13	9606.ENSP00000347823	0.536	Keratin, type I cytoskeletal 39
14	9606.ENSP00000366984	0.533	Keratin, type I cytoskeletal 40
15	9606.ENSP00000209718	0.528	Keratin, type I cytoskeletal 23
16	9606.ENSP00000257901	0.528	Keratin, type II cuticular Hb5
17	9606.ENSP00000366976	0.528	Keratin-associated protein 1-4
18	9606.ENSP00000225899	0.527	Keratin, type I cuticular Ha2
19	9606.ENSP00000377570	0.525	Keratin, type I cuticular Ha4
20	9606.ENSP00000264651	0.523	Keratin, type I cytoskeletal 24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.672	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.996	developmental process
GO:0009987	0.958	cellular process
GO:0048856	0.956	anatomical structure development
GO:0032501	0.954	multicellular organismal process
GO:0042303	0.893	molting cycle
GO:0008544	0.877	epidermis development
GO:0042633	0.849	hair cycle
GO:0071840	0.771	cellular component organization or biogenesis
GO:0016043	0.754	cellular component organization
GO:0007010	0.692	cytoskeleton organization
GO:0009653	0.606	anatomical structure morphogenesis
GO:0048513	0.601	animal organ development
GO:0060429	0.430	epithelium development
GO:0045103	0.323	intermediate filament-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005829	0.999	cytosol
GO:0005576	0.993	extracellular region
GO:0043227	0.991	membrane-bounded organelle
GO:0070062	0.975	extracellular exosome
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0005882	0.899	intermediate filament
GO:0043231	0.487	intracellular membrane-bounded organelle
GO:0045095	0.344	keratin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]