StarFunc result for job id Q7Z3Y9

User Input

>input (468 residues)
MSFRLSGGSRRICSRTGSGRLSGGGTGFVAGNVCVGSGARSSFSCTLEGISSGGSFCNSG
GGLGSGACAGFLGNEHSLLSGNEKVTMQNLNDRLASYLDHVHALEEANADLEQKIKGWYE
KCEPGSSREHDHDYSRYFSVIEDLKRQIISATICNASIVLQNDNARLTADDFRLKYENEL
ALHHSVEADTSGLRRVLDELTLCTTDLEIQCETLSEELTYLKKSHEEEMEVLQYTAGGNV
NVEMNATPGVDLTVLLNNMRAEYEDLAEQNRKDAEAWFNERSATLQQQISDHEGAATAAR
NELTELKRNLQTLEIELQSLMAVKHSYECSLAETEGNYCNQLQQIQDQIGVMEEQLQQIR
TETEGQKLEYEQLLDVKIFLEKEIDIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDS
TEETIVKTVVEELDQIGNLLSLRVHSVEEKSSKISNITVEQRVPSKAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3Y9	1.000	1.000	1.861E-63	468	1.000	1.000	Q7Z3Y9.pdb.gz	K1C26_HUMAN Keratin, type I cytoskeletal 26 OS=Homo sapiens OX=9606 GN=KRT26 PE=1 SV=2
2	AFDB:Q7Z3Y8	0.526	0.535	8.465E-42	459	0.716	0.730	Q7Z3Y8.pdb.gz	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
3	AFDB:Q7Z3Y7	0.449	0.452	8.323E-41	464	0.679	0.685	Q7Z3Y7.pdb.gz	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
4	AFDB:Q9Z320	0.688	0.715	2.352E-40	448	0.692	0.723	Q9Z320.pdb.gz	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
5	AFDB:Q7Z3Z0	0.391	0.404	4.872E-38	450	0.688	0.716	Q7Z3Z0.pdb.gz	K1C25_HUMAN Keratin, type I cytoskeletal 25 OS=Homo sapiens OX=9606 GN=KRT25 PE=1 SV=1
6	AFDB:Q99456	0.452	0.432	2.324E-27	494	0.476	0.451	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
7	AFDB:Q64291	0.469	0.456	5.719E-27	487	0.496	0.476	Q64291.pdb.gz	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
8	AFDB:Q6IFX1	0.422	0.406	9.287E-27	491	0.515	0.491	Q6IFX1.pdb.gz	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
9	AFDB:P02533	0.620	0.615	2.449E-26	472	0.472	0.468	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
10	AFDB:Q6IFV1	0.546	0.530	3.977E-26	485	0.447	0.431	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
11	PDB:3ul5D	0.035	0.162	1.010	84	0.015	0.083	3ul5D.pdb.gz
12	PDB:7egbA	0.050	0.044	3.059	558	0.024	0.020	7egbA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:2kqkA	0.044	0.144	3.279	128	0.019	0.070	2kqkA.pdb.gz
14	PDB:4mqwB	0.049	0.130	3.279	109	0.024	0.101	4mqwB.pdb.gz
15	PDB:3okrC	0.033	0.062	3.514	194	0.013	0.031	3okrC.pdb.gz	Crystal Structure of the Mycobacterium tuberculosis 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD): an antitubercular drug target
16	PDB:4p1wB	0.047	0.153	3.766	135	0.013	0.044	4p1wB.pdb.gz	Structural basis of starvation-induced assembly of the autophagy initiation complex.
17	PDB:1dw9A	0.051	0.119	4.636	156	0.017	0.051	1dw9A.pdb.gz
18	PDB:6yxxAf	0.033	0.088	4.968	139	0.015	0.050	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
19	PDB:3j7aZ	0.048	0.255	5.324	72	0.015	0.097	3j7aZ.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
20	PDB:6b5eB	0.038	0.061	5.706	286	0.019	0.031	6b5eB.pdb.gz	The structure of glucose-1-phosphate thymidylyltransferase from Mycobacterium tuberculosis reveals the location of an essential magnesium ion in the RmlA-type enzymes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3Y7	0.0	622	464	0.677	0.683	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
2	Q7Z3Y8	0.0	617	459	0.724	0.739	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
3	Q7Z3Y9	0.0	959	468	1.000	1.000	K1C26_HUMAN Keratin, type I cytoskeletal 26 OS=Homo sapiens OX=9606 GN=KRT26 PE=1 SV=2
4	Q7Z3Z0	0.0	606	450	0.686	0.713	K1C25_HUMAN Keratin, type I cytoskeletal 25 OS=Homo sapiens OX=9606 GN=KRT25 PE=1 SV=1
5	Q8VCW2	0.0	603	446	0.669	0.702	K1C25_MOUSE Keratin, type I cytoskeletal 25 OS=Mus musculus OX=10090 GN=Krt25 PE=1 SV=1
6	Q9Z320	0.0	602	448	0.688	0.719	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
7	P13645	1.02e-134	402	584	0.447	0.358	K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6
8	Q2M2I5	1.33e-133	397	525	0.451	0.402	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
9	Q64291	1.84e-130	388	487	0.451	0.433	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
10	Q99456	2.04e-130	388	494	0.432	0.409	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
11	P02535	7.79e-129	387	570	0.427	0.351	K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3
12	Q6IFX1	2.61e-126	377	491	0.459	0.438	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
13	Q6IFU8	2.14e-125	373	433	0.464	0.501	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
14	Q9QWL7	5.55e-125	372	433	0.468	0.506	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
15	P08779	7.98e-123	368	473	0.406	0.402	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
16	P02533	1.57e-121	365	472	0.395	0.392	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
17	P19001	1.98e-121	362	403	0.406	0.471	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
18	Q04695	3.02e-121	362	432	0.425	0.461	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
19	Q6IFV4	1.10e-120	361	438	0.404	0.432	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
20	K7ERE3	4.57e-120	359	415	0.400	0.451	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05791 Bacillus_HBL	6e+02	11.6	Bacillus haemolytic enterotoxin (HBL)
2	PF00038 Filament	3.4e-92	321.0	Intermediate filament protein
3	PF07352 Phage_Mu_Gam	8.3e+02	11.2	Bacteriophage Mu Gam like protein
4	PF02996 Prefoldin	3.9e+02	12.3	Prefoldin subunit
5	PF12999 PRKCSH-like	1.3e+02	13.8	Glucosidase II beta subunit-like
6	PF07926 TPR_MLP1_2	5.8	18.4	TPR/MLP1/MLP2-like protein
7	PF12718 Tropomyosin_1	8.4e+02	11.5	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334798

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347823	0.568	Keratin, type I cytoskeletal 39
2	9606.ENSP00000246646	0.557	Keratin, type I cuticular Ha8
3	9606.ENSP00000209718	0.540	Keratin, type I cytoskeletal 23
4	9606.ENSP00000366984	0.536	Keratin, type I cytoskeletal 40
5	9606.ENSP00000225550	0.534	Keratin, type I cuticular Ha7
6	9606.ENSP00000377558	0.531	Keratin, type I cuticular Ha5
7	9606.ENSP00000377570	0.531	Keratin, type I cuticular Ha4
8	9606.ENSP00000007735	0.529	Keratin, type I cuticular Ha3-I
9	9606.ENSP00000373487	0.527	Keratin, type I cytoskeletal 18
10	9606.ENSP00000246662	0.525	Keratin, type I cytoskeletal 9
11	9606.ENSP00000301653	0.521	Keratin, type I cytoskeletal 16
12	9606.ENSP00000251645	0.519	Keratin, type I cuticular Ha1
13	9606.ENSP00000264651	0.517	Keratin, type I cytoskeletal 24
14	9606.ENSP00000254043	0.516	Keratin, type I cytoskeletal 15
15	9606.ENSP00000308452	0.516	Keratin, type I cytoskeletal 17
16	9606.ENSP00000167586	0.515	Keratin, type I cytoskeletal 14
17	9606.ENSP00000251646	0.513	Keratin, type I cuticular Ha3-II
18	9606.ENSP00000251643	0.510	Keratin, type I cytoskeletal 12
19	9606.ENSP00000269576	0.508	Keratin, type I cytoskeletal 10
20	9606.ENSP00000355124	0.505	Keratin, type I cytoskeletal 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.648	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.992	developmental process
GO:0009987	0.926	cellular process
GO:0048856	0.924	anatomical structure development
GO:0045103	0.793	intermediate filament-based process
GO:0032501	0.662	multicellular organismal process
GO:0071840	0.533	cellular component organization or biogenesis
GO:0008544	0.498	epidermis development
GO:0016043	0.489	cellular component organization
GO:0007010	0.406	cytoskeleton organization
GO:0042633	0.366	hair cycle
GO:0045104	0.312	intermediate filament cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0005829	0.998	cytosol
GO:0043227	0.991	membrane-bounded organelle
GO:0005615	0.986	extracellular space
GO:0070062	0.977	extracellular exosome
GO:0043232	0.886	intracellular non-membrane-bounded organelle
GO:0045111	0.876	intermediate filament cytoskeleton
GO:0099512	0.873	supramolecular fiber
GO:0005882	0.857	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]