StarFunc result for job id Q7Z3Z0

User Input

>input (450 residues)
MSLRLSSASRRSCPRPTTGSLRLYGGGTSFGTGNSCGISGIGSGFSSAFGGSSSGGNTGG
GNPCAGFTVNERGLLSGNEKVTMQNLNDRLASYLDSVHALEEANADLEQKIKGWYEKFGP
GSCRGLDHDYSRYFPIIDDLKNQIIASTTSNANAVLQIDNARLTADDFRLKYENELALHQ
SVEADVNGLRRVLDEITLCRTDLEIQYETLSEEMTYLKKNHKEEMQVLQCAAGGNVNVEM
NAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISEDVGATTSARNELT
EMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQVRTETE
GQKLEYEQLLDIKLHLEKEIETYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAI
VVKKVLEEVDQRSKILTTRLHSLEEKSQSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3Z0	1.000	1.000	6.688E-61	450	1.000	1.000	Q7Z3Z0.pdb.gz	K1C25_HUMAN Keratin, type I cytoskeletal 25 OS=Homo sapiens OX=9606 GN=KRT25 PE=1 SV=1
2	AFDB:Q7Z3Y8	0.597	0.588	4.945E-47	459	0.813	0.797	Q7Z3Y8.pdb.gz	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
3	AFDB:Q9Z320	0.436	0.438	1.746E-43	448	0.778	0.781	Q9Z320.pdb.gz	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
4	AFDB:Q7Z3Y7	0.574	0.558	3.643E-42	464	0.740	0.718	Q7Z3Y7.pdb.gz	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
5	AFDB:Q7Z3Y9	0.403	0.390	9.113E-38	468	0.720	0.692	Q7Z3Y9.pdb.gz	K1C26_HUMAN Keratin, type I cytoskeletal 26 OS=Homo sapiens OX=9606 GN=KRT26 PE=1 SV=2
6	AFDB:Q99456	0.613	0.564	4.911E-27	494	0.522	0.476	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
7	AFDB:Q6IFX1	0.563	0.521	1.447E-26	491	0.560	0.513	Q6IFX1.pdb.gz	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
8	AFDB:Q64291	0.472	0.446	2.321E-26	487	0.536	0.495	Q64291.pdb.gz	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
9	AFDB:P02533	0.405	0.390	2.154E-25	472	0.504	0.481	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
10	AFDB:Q6IFV1	0.363	0.341	3.019E-25	485	0.471	0.437	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
11	PDB:7sqkC	0.166	0.132	4.425	600	0.124	0.093	7sqkC.pdb.gz
12	PDB:7sqkA	0.127	0.189	5.064	278	0.080	0.129	7sqkA.pdb.gz
13	PDB:5m64M	0.038	0.052	9.298	323	0.007	0.009	5m64M.pdb.gz	Molecular Structures of Transcribing RNA Polymerase I.
14	PDB:6adgC	0.048	0.055	9.298	390	0.013	0.015	6adgC.pdb.gz	Crystal structures of pan-IDH inhibitor AG-881 in complex with mutant human IDH1 and IDH2
15	PDB:7l08r	0.048	0.113	9.298	162	0.011	0.031	7l08r.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3Y7	0.0	669	464	0.740	0.718	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
2	Q7Z3Y8	0.0	706	459	0.813	0.797	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
3	Q7Z3Y9	0.0	632	468	0.722	0.694	K1C26_HUMAN Keratin, type I cytoskeletal 26 OS=Homo sapiens OX=9606 GN=KRT26 PE=1 SV=2
4	Q7Z3Z0	0.0	924	450	1.000	1.000	K1C25_HUMAN Keratin, type I cytoskeletal 25 OS=Homo sapiens OX=9606 GN=KRT25 PE=1 SV=1
5	Q8VCW2	0.0	819	446	0.911	0.919	K1C25_MOUSE Keratin, type I cytoskeletal 25 OS=Mus musculus OX=10090 GN=Krt25 PE=1 SV=1
6	Q9Z320	0.0	674	448	0.776	0.779	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
7	P13645	2.54e-145	429	584	0.478	0.368	K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6
8	Q2M2I5	1.19e-143	422	525	0.498	0.427	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
9	Q6IFX1	1.31e-142	418	491	0.487	0.446	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
10	Q64291	3.27e-140	412	487	0.478	0.441	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
11	P02535	2.44e-137	408	570	0.453	0.358	K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3
12	Q99456	5.34e-137	404	494	0.456	0.415	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
13	Q6IFU8	8.85e-133	391	433	0.480	0.499	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
14	P08779	9.66e-133	392	473	0.442	0.421	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
15	Q9QWL7	7.62e-132	389	433	0.484	0.503	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
16	Q04695	7.48e-129	381	432	0.438	0.456	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
17	P02533	1.21e-128	382	472	0.420	0.400	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
18	Q6IFV4	5.83e-128	379	438	0.429	0.441	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
19	Q61414	4.52e-126	375	452	0.418	0.416	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
20	Q6IFV1	7.13e-126	375	485	0.411	0.381	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	1.3e-93	325.7	Intermediate filament protein
2	PF07352 Phage_Mu_Gam	29	16.0	Bacteriophage Mu Gam like protein
3	PF07926 TPR_MLP1_2	63	15.0	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310573

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000007735	0.584	Keratin, type I cuticular Ha3-I
2	9606.ENSP00000251645	0.568	Keratin, type I cuticular Ha1
3	9606.ENSP00000251646	0.566	Keratin, type I cuticular Ha3-II
4	9606.ENSP00000377558	0.558	Keratin, type I cuticular Ha5
5	9606.ENSP00000246646	0.553	Keratin, type I cuticular Ha8
6	9606.ENSP00000366984	0.534	Keratin, type I cytoskeletal 40
7	9606.ENSP00000225550	0.531	Keratin, type I cuticular Ha7
8	9606.ENSP00000347823	0.531	Keratin, type I cytoskeletal 39
9	9606.ENSP00000225899	0.527	Keratin, type I cuticular Ha2
10	9606.ENSP00000264651	0.527	Keratin, type I cytoskeletal 24
11	9606.ENSP00000209718	0.526	Keratin, type I cytoskeletal 23
12	9606.ENSP00000377570	0.520	Keratin, type I cuticular Ha4
13	9606.ENSP00000246635	0.517	Keratin, type I cytoskeletal 13
14	9606.ENSP00000251643	0.516	Keratin, type I cytoskeletal 12
15	9606.ENSP00000246662	0.514	Keratin, type I cytoskeletal 9
16	9606.ENSP00000329165	0.513	Keratin, type I cuticular Ha6
17	9606.ENSP00000301653	0.512	Keratin, type I cytoskeletal 16
18	9606.ENSP00000254043	0.511	Keratin, type I cytoskeletal 15
19	9606.ENSP00000308452	0.511	Keratin, type I cytoskeletal 17
20	9606.ENSP00000167586	0.509	Keratin, type I cytoskeletal 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.688	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.996	developmental process
GO:0048856	0.992	anatomical structure development
GO:0009987	0.969	cellular process
GO:0042303	0.968	molting cycle
GO:0042633	0.962	hair cycle
GO:0071840	0.894	cellular component organization or biogenesis
GO:0016043	0.878	cellular component organization
GO:0006996	0.836	organelle organization
GO:0008544	0.802	epidermis development
GO:0007010	0.789	cytoskeleton organization
GO:0007568	0.478	aging
GO:0045103	0.432	intermediate filament-based process
GO:0045104	0.420	intermediate filament cytoskeleton organization
GO:0009653	0.403	anatomical structure morphogenesis
GO:0043588	0.379	skin development
GO:0022404	0.315	molting cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005829	0.999	cytosol
GO:0043227	0.998	membrane-bounded organelle
GO:0070062	0.991	extracellular exosome
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0099512	0.862	supramolecular fiber
GO:0005882	0.850	intermediate filament
GO:0043231	0.494	intracellular membrane-bounded organelle
GO:0045095	0.328	keratin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]