StarFunc result for job id Q7Z3Z2

User Input

>input (195 residues)
MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDY
SWLASTPRSTYDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRS
VLQEVLERMKQEEEAHKLTRQWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPP
LRSWSMPEFRAPKAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z3Z2	1.000	1.000	1.201E-29	195	1.000	1.000	Q7Z3Z2.pdb.gz	RD3_HUMAN Protein RD3 OS=Homo sapiens OX=9606 GN=RD3 PE=1 SV=1
2	AFDB:Q8BRE0	0.821	0.821	3.915E-25	195	0.856	0.856	Q8BRE0.pdb.gz	RD3_MOUSE Protein RD3 OS=Mus musculus OX=10090 GN=Rd3 PE=1 SV=1
3	AFDB:Q9USP7	0.238	0.134	2.081E-1	397	0.185	0.091	Q9USP7.pdb.gz	YHP6_SCHPO Uncharacterized protein C902.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC902.06 PE=1 SV=1
4	AFDB:B8JI50	0.220	0.101	3.672E-1	464	0.185	0.078	B8JI50.pdb.gz
5	AFDB:A0A2R8RR02	0.125	0.036	9.109E-1	1101	0.108	0.019	A0A2R8RR02.pdb.gz	A0A2R8RR02_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak PE=1 SV=1
6	AFDB:A0A0H2UQC2	0.155	0.069	1.080	523	0.123	0.046	A0A0H2UQC2.pdb.gz	A0A0H2UQC2_STRPN Signal recognition particle protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ffh PE=1 SV=1
7	AFDB:P93286	0.154	0.085	1.080	442	0.169	0.075	P93286.pdb.gz	CCMFC_ARATH Cytochrome c biogenesis CcmF C-terminal-like mitochondrial protein OS=Arabidopsis thaliana OX=3702 GN=CCMFC PE=1 SV=3
8	AFDB:Q3UZT2	0.185	0.182	1.080	198	0.154	0.152	Q3UZT2.pdb.gz	Q3UZT2_MOUSE Paralemmin-2 OS=Mus musculus OX=10090 GN=Pakap PE=2 SV=1
9	AFDB:Q54BP1	0.164	0.025	1.080	2110	0.123	0.011	Q54BP1.pdb.gz	Q54BP1_DICDI Centrosomal protein 248 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293544 PE=4 SV=1
10	AFDB:Q3V089	0.203	0.052	1.210	1013	0.144	0.028	Q3V089.pdb.gz	RBM44_MOUSE RNA-binding protein 44 OS=Mus musculus OX=10090 GN=Rbm44 PE=1 SV=1
11	PDB:7ajuUL	0.185	0.070	1.829	779	0.123	0.031	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:3geiC	0.142	0.104	2.168	298	0.097	0.064	3geiC.pdb.gz
13	PDB:2wssA	0.181	0.085	3.226	510	0.118	0.045	2wssA.pdb.gz	The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
14	PDB:3geiA	0.120	0.062	3.415	428	0.056	0.026	3geiA.pdb.gz
15	PDB:4jrzA	0.163	0.197	3.615	155	0.128	0.161	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
16	PDB:4xguB	0.205	0.115	3.615	382	0.087	0.045	4xguB.pdb.gz	TRIP13 is a protein-remodeling AAA+ ATPase that catalyzes MAD2 conformation switching.
17	PDB:7vrcC	0.174	0.287	3.615	109	0.036	0.064	7vrcC.pdb.gz
18	PDB:6vq6H	0.171	0.156	3.826	214	0.103	0.093	6vq6H.pdb.gz	Structure of V-ATPase from the mammalian brain.
19	PDB:1dj8A	0.180	0.402	4.286	79	0.026	0.063	1dj8A.pdb.gz
20	PDB:2w6gG	0.208	0.274	4.286	140	0.092	0.129	2w6gG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3Z2	2.11e-141	393	195	1.000	1.000	RD3_HUMAN Protein RD3 OS=Homo sapiens OX=9606 GN=RD3 PE=1 SV=1
2	Q8BRE0	2.57e-123	348	195	0.856	0.856	RD3_MOUSE Protein RD3 OS=Mus musculus OX=10090 GN=Rd3 PE=1 SV=1
3	Q9SCV3	0.62	33.1	887	0.087	0.019	BGAL9_ARATH Beta-galactosidase 9 OS=Arabidopsis thaliana OX=3702 GN=BGAL9 PE=2 SV=1
4	Q5SXY1	1.5	32.0	1067	0.118	0.022	CYTSB_MOUSE Cytospin-B OS=Mus musculus OX=10090 GN=Specc1 PE=1 SV=2
5	Q9VJD1	3.5	30.8	548	0.113	0.040	Q9VJD1_DROME Glucosidase 2 subunit beta OS=Drosophila melanogaster OX=7227 GN=GCS2beta PE=1 SV=1
6	A1YBN2	3.6	30.8	790	0.108	0.027	A1YBN2_AERVE Conjugal transfer protein OS=Aeromonas veronii OX=654 GN=traE PE=3 SV=1
7	J3QS22	6.9	30.0	783	0.118	0.029	J3QS22_HUMAN Sperm antigen with calponin homology and coiled-coil domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=9

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11799 IMS_C	2.4e+02	13.6	impB/mucB/samB family C-terminal domain
2	PF14473 RD3	7.1e-42	153.7	RD3 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355969

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259512	0.919	Derlin-1
2	9606.ENSP00000254854	0.916	Retinal guanylyl cyclase 1
3	9606.ENSP00000230381	0.892	Peripherin-2
4	9606.ENSP00000420295	0.871	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
5	9606.ENSP00000305426	0.824	Tubby protein homolog
6	9606.ENSP00000376686	0.802	Lebercilin
7	9606.ENSP00000377176	0.793	Spermatogenesis-associated protein 7
8	9606.ENSP00000416250	0.741	Translation initiation factor eIF-2B subunit alpha
9	9606.ENSP00000229771	0.734	Tubby-related protein 1
10	9606.ENSP00000377784	0.733	Guanylyl cyclase-activating protein 1
11	9606.ENSP00000366395	0.724	E3 ubiquitin-protein ligase synoviolin
12	9606.ENSP00000316605	0.723	Cyclic nucleotide-gated cation channel beta-3
13	9606.ENSP00000370521	0.720	Aryl-hydrocarbon-interacting protein-like 1
14	9606.ENSP00000465932	0.718	Progressive rod-cone degeneration protein
15	9606.ENSP00000391664	0.707	Membrane frizzled-related protein
16	9606.ENSP00000481824	0.707	Membrane frizzled-related protein
17	9606.ENSP00000356370	0.703	Protein crumbs homolog 1
18	9606.ENSP00000378167	0.696	Microtubule-binding protein required for ciliogenesis . May function in ciliogenesis by mediating the transport of proteins like BBS4 to the cilium, but also through the organization of the centriolar satellites . Plays a role in retina morphogenesis and/or homeostasis (By similarity).
19	9606.ENSP00000385158	0.694	Protein FAM161A
20	9606.ENSP00000449079	0.688	Retinol dehydrogenase 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0051179	0.967	localization
GO:0006810	0.936	transport
GO:0031326	0.884	regulation of cellular biosynthetic process
GO:0019219	0.870	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.826	negative regulation of cellular process
GO:0019220	0.826	regulation of phosphate metabolic process
GO:0062012	0.812	regulation of small molecule metabolic process
GO:0050790	0.797	regulation of catalytic activity
GO:0006140	0.796	regulation of nucleotide metabolic process
GO:0044092	0.771	negative regulation of molecular function
GO:0051172	0.761	negative regulation of nitrogen compound metabolic process
GO:0031324	0.757	negative regulation of cellular metabolic process
GO:0051339	0.718	regulation of lyase activity
GO:0031279	0.718	regulation of cyclase activity
GO:0010563	0.659	negative regulation of phosphorus metabolic process
GO:1900542	0.648	regulation of purine nucleotide metabolic process
GO:0062014	0.632	negative regulation of small molecule metabolic process
GO:0030808	0.610	regulation of nucleotide biosynthetic process
GO:0071702	0.598	organic substance transport
GO:0045936	0.585	negative regulation of phosphate metabolic process
GO:0043086	0.581	negative regulation of catalytic activity
GO:1900371	0.531	regulation of purine nucleotide biosynthetic process
GO:0032501	0.523	multicellular organismal process
GO:0050896	0.408	response to stimulus
GO:0033036	0.376	macromolecule localization
GO:0015031	0.339	protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.999	cytoplasm
GO:0005929	0.869	cilium
GO:0048471	0.758	perinuclear region of cytoplasm
GO:0016020	0.753	membrane
GO:0097730	0.657	non-motile cilium
GO:0097733	0.575	photoreceptor cell cilium
GO:0005829	0.488	cytosol
GO:0001917	0.484	photoreceptor inner segment
GO:0001750	0.429	photoreceptor outer segment
GO:0032991	0.369	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]